Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.39
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dentin dysplasia 19 4.539 2.3

Expression

Synonym

Accession Q9Y2M2 A6NFA9 B3KS84 B7Z6E3 F5H2S5 Q7Z7K4
Symbols SSU-2
fls485
C3orf32

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPSPVGLLRALPLPWPQFLACTLRRLAGPRESTGPSQKPPPLCSVPCRVPAMTEEVAREALLSFVDSKCC      1 - 70
YSSTVAGDLVIQELKRQTLCRYRLETFSESRISEWTFQPFTNHSVDGPQRGASPRLWDIKVQGPPMFQED     71 - 140
TRKFQVPHSSLVKECHKCHGRGRYKCSGCHGAGTVRCPSCCGAKRKAKQSRRCQLCAGSGRRRCSTCSGR    141 - 210
GNKTCATCKGEKKLLHFIQLVIMWKNSLFEFVSEHRLNCPRELLAKAKGENLFKDENSVVYPIVDFPLRD    211 - 280
ISLASQRGIAEHSAALASRARVLQQRQTIELIPLTEVHYWYQGKTYVYYIYGTDHQVYAVDYPERYCCGC    281 - 350
TIV                                                                       351 - 353
//

Text Mined References (8)

PMID Year Title