Property Summary

NCBI Gene PubMed Count 27
PubMed Score 115.92
PubTator Score 51.01

Knowledge Summary


No data available


  Disease (7)

Disease Target Count P-value
ovarian cancer 8519 9.5e-07
osteosarcoma 7950 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.9


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.207 1.1e-03
ovarian cancer -1.100 9.5e-07

Gene RIF (19)

AA Sequence

DRLSHKQMIWLAELQKLGAEVEVCHVVAVGAKSQSLS                                     981 - 1017

Text Mined References (31)

PMID Year Title