Property Summary

NCBI Gene PubMed Count 25
Grant Count 16
R01 Count 7
Funding $2,145,937.83
PubMed Score 105.97
PubTator Score 51.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.082 0.000
ovarian cancer -1.100 0.000

Gene RIF (17)

PMID Text
26221031 EXO1 and FEN1 cleaved the substrate at the boundary between the single-stranded 5' flap and the duplex, whereas FAN1 incised it three to four nucleotides in the double-stranded region.
26052075 Detected FAN1 mutations in approximately 3% of families who met the Amsterdam criteria for hereditary colorectal cancer and had mismatch repair-proficient cancers with no previously associated mutations.
25922199 FAN1 efficiently promoted DNA incision at the proper site of RPA-coated 5'-flapped DNA. Therefore, FAN1 possesses the ability to promote the ICL repair of 5'-flapped DNA covered by RPA.
25500724 The crystal structures of human FAN1 in complex with a 5' flap DNA substrate show that two FAN1 molecules form a head-to-tail dimer to locate the lesion, orient the DNA, and unwind a 5' flap for subsequent incision.
25430771 In this work, FAN1-DNA crystal structures and biochemical data reveal that human FAN1 cleaves DNA successively at every third nucleotide
25135477 Results show that FAN1 utilizes its nuclease activity-in cooperation with the BLM-FANCD2 complex-to promote replication fork restart and simultaneous suppression of new origin firing.
24344280 FAN1 encodes a DNA repair enzyme, thus implicating abnormalities in DNA repair in the susceptibility to schizophrenia or autism
22854063 FAN1 might be a new mitotic substrate of APC/CCdh1 that plays a key role during mitotic exit.
22772369 By exome sequencing, we identified mutations in FAN1 as a cause of karyomegalic interstitial nephritis, a disorder that serves as a model for renal fibrosis.
22611161 Our results suggest that FAN1 has a minor role in interstrand crosslink repair compared with true Fanconi anemia genes and exclude FAN1 as a novel FA gene.
More...

AA Sequence

MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHLDEMCANNDFV      1 - 70
QVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKREVKQKISPYFKSNDVVCKNQD     71 - 140
ELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSSPQSSKSTVVKSLIDNSSEIEDEDQILENSS    141 - 210
QKENVFKCDSLKEECIPEHMVRGSKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSE    211 - 280
DSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNND    281 - 350
IPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVR    351 - 420
LFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPN    421 - 490
GQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRAKALAGQSVRICKGPRAVFSRILLLFSLTDSMED    491 - 560
EDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTHIFQDRDDLIRYAAATHMLSDISSAMANGNWEEAKEL    561 - 630
AQCAKRDWNRLKNHPSLRCHEDLPLFLRCFTVGWIYTRILSRFVEILQRLHMYEEAVRELESLLSQRIYC    631 - 700
PDSRGRWWDRLALNLHQHLKRLEPTIKCITEGLADPEVRTGHRLSLYQRAVRLRESPSCKKFKHLFQQLP    701 - 770
EMAVQDVKHVTITGRLCPQRGMCKSVFVMEAGEAADPTTVLCSVEELALAHYRRSGFDQGIHGEGSTFST    771 - 840
LYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFTSRRPALEARLQLIHDAPEESLRAWVAATWHEQE    841 - 910
GRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPN    911 - 980
DRLSHKQMIWLAELQKLGAEVEVCHVVAVGAKSQSLS                                     981 - 1017
//

Text Mined References (29)

PMID Year Title
26221031 2015 FANCD2-associated nuclease 1, but not exonuclease 1 or flap endonuclease 1, is able to unhook DNA interstrand cross-links in vitro.
26052075 2015 Germline Mutations in FAN1 Cause Hereditary Colorectal Cancer by Impairing DNA Repair.
25922199 2015 Human FAN1 promotes strand incision in 5'-flapped DNA complexed with RPA.
25500724 2014 Structural insights into 5' flap DNA unwinding and incision by the human FAN1 dimer.
25430771 2014 DNA repair. Mechanism of DNA interstrand cross-link processing by repair nuclease FAN1.
25135477 2014 FANCD2-controlled chromatin access of the Fanconi-associated nuclease FAN1 is crucial for the recovery of stalled replication forks.
24981866 2014 FAN1 activity on asymmetric repair intermediates is mediated by an atypical monomeric virus-type replication-repair nuclease domain.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24344280 2014 Scan statistic-based analysis of exome sequencing data identifies FAN1 at 15q13.3 as a susceptibility gene for schizophrenia and autism.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...