Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.51
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.99051545355745E-16
non-small cell lung cancer 2798 7.92794018642214E-16
posterior fossa group A ependymoma 1511 4.49100438115685E-9
Breast cancer 3099 7.15421807982724E-8
osteosarcoma 7933 3.67692571443669E-7
ulcerative colitis 2087 2.82466739052037E-6
glioblastoma 5572 7.25509331605767E-6
psoriasis 6685 4.74996254239746E-5
malignant mesothelioma 3163 4.92241283830519E-5
pilocytic astrocytoma 3086 1.68823849159812E-4
atypical teratoid / rhabdoid tumor 4369 1.93777319077925E-4
primary pancreatic ductal adenocarcinoma 1271 5.46878063853748E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.46481936733056E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.02955422584585E-4
pediatric high grade glioma 2712 9.62088359149304E-4
group 3 medulloblastoma 2254 0.00183942941696823
pancreatic cancer 2300 0.00204113816661256
medulloblastoma, large-cell 6234 0.0042196796476912
ovarian cancer 8492 0.00656862965355231
subependymal giant cell astrocytoma 2287 0.0139098355713957
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0157567647940073
Disease Target Count Z-score Confidence
Osteoarthritis 96 3.675 1.8

Expression

Synonym

Accession Q9Y2L9 B7ZLL5 F8W6F0 Q17R43 Q2KHR1 Q5TBU9 Q7Z5F6 Q7Z5F7
Symbols NP81
CHDC1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (6)

PMID Text
22325041 Letter: Did not observe an association between LRCH-1 SNPs and knee osteoarthritis.
20237151 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
18049793 results suggest that there is no association between LRCH1 and knee osteoarthritis susceptibility
16891653 Observational study of gene-disease association. (HuGE Navigator)
16447229 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16447229 A genetic variant in LRCH1 was consistently associated with knee osteoarthritis in 3 samples from 2 populations.

AA Sequence

MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLNRGLERALEEA      1 - 70
ANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIV     71 - 140
NLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQL    141 - 210
KSLRELNVRRNYLKVLPQELVDLSLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGK    211 - 280
VHIFKYLSIQACQIKTADSLYLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVP    281 - 350
MSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED    351 - 420
CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNLYPMGSAEALE    421 - 490
LQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTNSTAPFGLKPRSVFLRPQRNL    491 - 560
ESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVP    561 - 630
SPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRS    631 - 700
RDLIGFCLVHILFIVLVYITYHWNALSA                                              701 - 728
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22325041 Genetic association analysis of LRCH-1 for knee osteoarthritis.
20805893 2010 LRCH proteins: a novel family of cytoskeletal regulators.
20237151 2010 Field synopsis and synthesis of genetic association studies in osteoarthritis: the CUMAGAS-OSTEO information system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18049793 2008 Lack of association of single nucleotide polymorphism in LRCH1 with knee osteoarthritis susceptibility.
17762607 2007 New gene associations in osteoarthritis: what do they provide, and where are we going?
More...