Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $10,129
PubMed Score 7.51
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22325041 Letter: Did not observe an association between LRCH-1 SNPs and knee osteoarthritis.
20237151 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
18049793 results suggest that there is no association between LRCH1 and knee osteoarthritis susceptibility
16891653 Observational study of gene-disease association. (HuGE Navigator)
16447229 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16447229 A genetic variant in LRCH1 was consistently associated with knee osteoarthritis in 3 samples from 2 populations.

AA Sequence

MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLNRGLERALEEA      1 - 70
ANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIV     71 - 140
NLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQL    141 - 210
KSLRELNVRRNYLKVLPQELVDLSLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGK    211 - 280
VHIFKYLSIQACQIKTADSLYLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVP    281 - 350
MSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED    351 - 420
CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNLYPMGSAEALE    421 - 490
LQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTNSTAPFGLKPRSVFLRPQRNL    491 - 560
ESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVP    561 - 630
SPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRS    631 - 700
RDLIGFCLVHILFIVLVYITYHWNALSA                                              701 - 728
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22325041 Genetic association analysis of LRCH-1 for knee osteoarthritis.
20805893 2010 LRCH proteins: a novel family of cytoskeletal regulators.
20237151 2010 Field synopsis and synthesis of genetic association studies in osteoarthritis: the CUMAGAS-OSTEO information system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18049793 2008 Lack of association of single nucleotide polymorphism in LRCH1 with knee osteoarthritis susceptibility.
17762607 2007 New gene associations in osteoarthritis: what do they provide, and where are we going?
More...