Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.26
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 1.8e-02
Astrocytoma, Pilocytic -1.600 1.3e-04
atypical teratoid / rhabdoid tumor -1.600 1.9e-04
Breast cancer -1.100 4.0e-09
ependymoma -1.900 3.1e-12
glioblastoma -1.500 7.3e-06
group 3 medulloblastoma 2.500 1.8e-03
intraductal papillary-mucinous adenoma (... 1.100 8.0e-04
intraductal papillary-mucinous carcinoma... 1.100 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.800 7.5e-04
lung adenocarcinoma -1.500 2.0e-16
malignant mesothelioma 1.600 4.9e-05
medulloblastoma, large-cell 1.700 4.2e-03
non-small cell lung cancer -1.061 7.9e-16
osteosarcoma -2.553 3.7e-07
ovarian cancer 1.200 6.6e-03
pancreatic cancer 2.000 2.0e-03
primary pancreatic ductal adenocarcinoma 1.975 5.5e-04
psoriasis -3.100 4.7e-05
subependymal giant cell astrocytoma -2.281 1.4e-02
ulcerative colitis 1.200 2.8e-06

Gene RIF (7)

AA Sequence

MATPGSEPQPFVPALSVATLHPLHHPHHHHHHHQHHGGTGAPGGAGGGGGGSGGFNLPLNRGLERALEEA      1 - 70
ANSGGLNLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIV     71 - 140
NLQMLTYLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQL    141 - 210
KSLRELNVRRNYLKVLPQELVDLSLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGK    211 - 280
VHIFKYLSIQACQIKTADSLYLHTMERPHLHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVP    281 - 350
MSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKARAED    351 - 420
CEELLRIEEDVHWQTEGIISSSKDQDMDIAMIEQLREAVDLLQDPNGLSTDITERSVLNLYPMGSAEALE    421 - 490
LQDSALNGQIQLETSPVCEVQSDLTLQSNGSQYSPNEIRENSPAVSPTTNSTAPFGLKPRSVFLRPQRNL    491 - 560
ESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVP    561 - 630
SPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSPCDILQLDFRHIRKTVDTLLALGEKAPPPTSALRS    631 - 700
RDLIGFCLVHILFIVLVYITYHWNALSA                                              701 - 728
//

Text Mined References (22)

PMID Year Title