Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.77
PubTator Score 2.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.32674730280001E-5
lung cancer 4473 0.00244425826810962
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00913927983259117
Disease Target Count Z-score Confidence
Pharyngitis 17 3.432 1.7
Rheumatic fever 16 3.369 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 0.009
lung cancer 1.300 0.002
group 4 medulloblastoma 1.200 0.000

Synonym

Accession Q9Y2L8 A4D280 D6W5S9
Symbols ZFP95
ZFP-95
ZNF914
ZSCAN37

Gene

PDB

2EM5   2EMM   2EMZ   2EN3   2EOM   2EON   2EOO   2YSO   2YTG  

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFYQRFRHFQYHEASGPREALSQ      1 - 70
LRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEEAVAVIENIQRELEERRQQIV     71 - 140
ACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTG    141 - 210
SQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHW    211 - 280
VAPEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQSTHGERGHRCSD    281 - 350
CGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH    351 - 420
HSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQRCSDKRSKNTKLSVKKKISEYSEADMELSGKT    421 - 490
QRNVSQVQDFGEGCEFQGKLDRKQGIPMKEILGQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQ    491 - 560
SAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGE    561 - 630
RPFKCNECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGICEEAYSW    631 - 700
NLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQHYRTHTAEKPYQCDICRENVGQCSHTKQHQKIYSST    701 - 770
KSHQCHECGRGFTLKSHLNQHQRIHTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPINTLSVEGSLL     771 - 839
//

Text Mined References (14)

PMID Year Title
26657034 2016 Macaca specific exon creation event generates a novel ZKSCAN5 transcript.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314882 Sequence diversity and haplotype structure at the human CYP3A cluster.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...