Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 6
Funding $313,685.83
PubMed Score 4.73
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.100 0.001
oligodendroglioma -1.100 0.000
osteosarcoma 1.045 0.028
glioblastoma 1.300 0.000
group 3 medulloblastoma 2.900 0.001
primitive neuroectodermal tumor 1.900 0.000
adrenocortical carcinoma -1.199 0.008
non-small cell lung cancer -1.384 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.036
lung cancer -1.800 0.002
diabetes mellitus -1.100 0.002
lung adenocarcinoma -1.200 0.000
pilocytic astrocytoma 1.100 0.020
nasopharyngeal carcinoma -1.200 0.002
lung carcinoma -1.900 0.000
Breast cancer -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.169 0.022
invasive ductal carcinoma -1.300 0.001
ovarian cancer -2.700 0.000
pituitary cancer 1.900 0.003
Down syndrome 1.500 0.002

Gene RIF (6)

PMID Text
20718813 association between the intronic rs6787362 FRMD4B SNP and ischemic cardiomyopathy in a European-derived population, but not FRMD4B variants as susceptibility factors in common heart failure
20718813 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20124441 SNP is located in a 3' intronic region of the FRMD4B gene. FRMD4B as novel susceptibility loci for advanced heart failure.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRHCQVHLLDDRR      1 - 70
LELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRVLDHDLPKKPGPTILHFAVRF     71 - 140
YIESISFLKDKTTVELFFLNAKACVHKGQIEVESETIFKLAAFILQEAKGDYTSDENARKDLKTLPAFPT    141 - 210
KTLQEHPSLAYCEDRVIEHYLKIKGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIG    211 - 280
QYDIQDKVKPRKLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMA    281 - 350
ISQHQFYLDRKQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLETKSQFIMASNGSLISSGSQDSEVSE    351 - 420
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRRVGTAFKLDDN    421 - 490
LLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTDAMKKLQEIENAINEYRIRCG    491 - 560
KKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTFPGQRSSSVPHSPRILPPKSLGIERIHFRKSSIN    561 - 630
EQFVDTRQSREMLSTHSSPYKTLERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSH    631 - 700
LLSEMDSDKPFFSLSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQN    701 - 770
VSTSNSGSMPNLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR    771 - 840
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLRGWYQRASGQK    841 - 910
DQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYT    911 - 980
SCYGNVYNPLPSPSRQYTEISQLDGTDGNQLEDNLESSEQRLFWHEDSKPGTLV                    981 - 1034
//

Text Mined References (16)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20718813 2010 Association of an intronic, but not any exonic, FRMD4B sequence variant and heart failure.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20124441 2010 Common variants in HSPB7 and FRMD4B associated with advanced heart failure.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18088087 2008 Phosphoproteome of resting human platelets.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
More...