Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.93
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.199 8.0e-03
Astrocytoma, Pilocytic 1.100 2.5e-02
Breast cancer -1.400 4.8e-08
diabetes mellitus -1.100 1.7e-03
Down syndrome 1.500 2.3e-03
glioblastoma 1.100 9.5e-04
group 3 medulloblastoma 2.900 1.1e-03
intraductal papillary-mucinous adenoma (... 1.200 3.6e-02
invasive ductal carcinoma -1.300 5.3e-04
lung adenocarcinoma -1.200 4.1e-13
lung cancer -1.100 3.4e-02
lung carcinoma -1.900 8.2e-28
mucosa-associated lymphoid tissue lympho... 1.169 2.2e-02
nasopharyngeal carcinoma -1.200 2.3e-03
non-small cell lung cancer -1.384 2.0e-17
oligodendroglioma -1.100 1.4e-04
osteosarcoma 1.045 2.8e-02
ovarian cancer -2.700 1.1e-05
pituitary cancer 1.900 2.5e-03
primitive neuroectodermal tumor 1.900 9.9e-05
psoriasis 1.100 6.9e-04

Gene RIF (6)

AA Sequence

MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRHCQVHLLDDRR      1 - 70
LELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRVLDHDLPKKPGPTILHFAVRF     71 - 140
YIESISFLKDKTTVELFFLNAKACVHKGQIEVESETIFKLAAFILQEAKGDYTSDENARKDLKTLPAFPT    141 - 210
KTLQEHPSLAYCEDRVIEHYLKIKGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIG    211 - 280
QYDIQDKVKPRKLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMA    281 - 350
ISQHQFYLDRKQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLETKSQFIMASNGSLISSGSQDSEVSE    351 - 420
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRRVGTAFKLDDN    421 - 490
LLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTDAMKKLQEIENAINEYRIRCG    491 - 560
KKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTFPGQRSSSVPHSPRILPPKSLGIERIHFRKSSIN    561 - 630
EQFVDTRQSREMLSTHSSPYKTLERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSH    631 - 700
LLSEMDSDKPFFSLSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQN    701 - 770
VSTSNSGSMPNLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR    771 - 840
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLRGWYQRASGQK    841 - 910
DQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYT    911 - 980
SCYGNVYNPLPSPSRQYTEISQLDGTDGNQLEDNLESSEQRLFWHEDSKPGTLV                    981 - 1034
//

Text Mined References (17)

PMID Year Title