Property Summary

NCBI Gene PubMed Count 31
Grant Count 12
R01 Count 8
Funding $761,701.82
PubMed Score 62.96
PubTator Score 28.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
oligodendroglioma 1.500 0.030
osteosarcoma -1.583 0.000
group 3 medulloblastoma 1.300 0.014
Breast cancer 2.500 0.025
invasive ductal carcinoma -1.200 0.004
ovarian cancer -1.600 0.000

Gene RIF (10)

PMID Text
26305418 Data indicate the pathological relevance of exosome component 11 protein (DIS3) mutations in plasma cell dyscrasias and suggest that DIS3 may represent a potential tumor suppressor gene in such disorders.
26193331 structure and function of DIS3
25925570 The study establishes that the ribonuclease DIS3, targeting LIN28B, sustains the maturation of let-7 miRNAs and suggests the increased translation of critical oncogenes as one of the biological outcomes of DIS3 inactivation.
25521164 seven novel somatic DIS3 single nucleotide variants (SNVs) and defined three hot spot mutations within the RNB domain.
24478024 Overexpression of DIS3 and LRCH1 associated with adenoma to carcinoma progression is linked to the colorectal cancer specific gain of 13q.
24150935 Multiple myeloma-associated hDIS3 mutations interfere with hDIS3 exonucleolytic activity.
20531386 Data show that hDIS3 and hDIS3L are active exonucleases, but only hDIS3 has retained endonucleolytic activity, and suggest that three different ribonucleases can serve as catalytic subunits for the exosome in human cells.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring. There appears to be no interaction between human dis3 and other exosome subunits, however.
9562621 S. cerevisiae Dis3p is identical to Rrp44p, which comprises the exosome involved in ribosomal RNA processing, S. cerevisiae Dis3p was found to be localized in the nucleolus.
9562621 Dis3p is identical to Rrp44p, which comprises the exosome involved in ribosomal RNA processing. Similar to S. cerevisiae Dis3p, human Dis3p enhanced RCC1-stimulated nucleotide release from Ran, in a dose-dependent manner, and bound to GTP- or GDP-Ran.

AA Sequence

MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSVCPQPHYLLPDT      1 - 70
NVLLHQIDVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGEN     71 - 140
ANDRNDRAIRVAAKWYNEHLKKMSADNQLQVIFITNDRRNKEKAIEEGIPAFTCEEYVKSLTANPELIDR    141 - 210
LACLSEEGNEIESGKIIFSEHLPLSKLQQGIKSGTYLQGTFRASRENYLEATVWIHGDNEENKEIILQGL    211 - 280
KHLNRAVHEDIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKMLKPTGRVVGIIK    281 - 350
RNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASTLEGRRIIVAIDGWPRNSRYPNGHFVRNL    351 - 420
GDVGEKETETEVLLLEHDVPHQPFSQAVLSFLPKMPWSITEKDMKNREDLRHLCICSVDPPGCTDIDDAL    421 - 490
HCRELENGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLKCDVDRLAF    491 - 560
SCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGAL    561 - 630
TLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYE    631 - 700
ILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASP    701 - 770
IYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFF    771 - 840
KSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVK    841 - 910
IMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK                          911 - 958
//

Text Mined References (36)

PMID Year Title
26305418 2015 A compendium of DIS3 mutations and associated transcriptional signatures in plasma cell dyscrasias.
26193331 2015 The 3' to 5' Exoribonuclease DIS3: From Structure and Mechanisms to Biological Functions and Role in Human Disease.
25925570 2015 The ribonuclease DIS3 promotes let-7 miRNA maturation by degrading the pluripotency factor LIN28B mRNA.
25521164 2015 The molecular spectrum and clinical impact of DIS3 mutations in multiple myeloma.
24478024 2014 Gene-dosage dependent overexpression at the 13q amplicon identifies DIS3 as candidate oncogene in colorectal cancer progression.
24150935 2014 Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target.
23756462 2013 Exonuclease hDIS3L2 specifies an exosome-independent 3'-5' degradation pathway of human cytoplasmic mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
More...