Property Summary

NCBI Gene PubMed Count 38
Grant Count 5
R01 Count 5
Funding $192,608.71
PubMed Score 30.78
PubTator Score 35.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.800 0.000
osteosarcoma 2.964 0.000
astrocytoma 1.100 0.011
juvenile dermatomyositis 1.296 0.000
pancreatic ductal adenocarcinoma liver m... 1.898 0.003
ovarian cancer 2.000 0.000
dermatomyositis 1.400 0.001

Synonym

Accession Q9Y2K7 D4QA03 E9PIL6 I3VM55 Q49A21 Q4G0M3 Q69YY8 Q9BVH5 Q9H7H5 Q9UK66
Symbols FBL7
CXXC8
FBL11
FBXL11
JHDM1A
LILINA

Gene

PDB

2YU1   2YU2   4BBQ  

Gene RIF (19)

PMID Text
26416883 The results suggest that under mild glucose starvation AMP-activated kinase induces KDM2A-dependent reduction of rRNA transcription to control cell proliferation.
26207617 Findings suggest that amplification and overexpression of the KDM2A short isoform is critical in breast cancer progression.
26037310 FBXL11 is proposed as a novel component of the circadian clock that regulates the circadian gene expression by a so far unknown mechanism.
26004508 The protein lysine demethylases Kdm2a and Kdm2b regulate the turnover of non-phosphorylated beta-catenin specifically within the nucleus via direct interaction with the fourth and fifth armadillo repeats.
25823024 In this study, KDM2A was identified as a novel substrate of ATM. DSB enhanced the interaction between ATM and KDM2A, which induced ATM-mediated phosphorylation of KDM2A at T632.
25245333 Upregulation of KDM2A is very important in the progression of gastric cancer.
25029110 a regulatory role for KDM2A in breast cancer cell invasion and migration, through the regulation of E2F1 function
24553073 KDM2A binds to the rDNA promoter with unmethylated CpG sequences via the CxxC-ZF domain
24482232 KDM2A represses histone deacetylase 3 and has a role in tumorigenicity of lung cancer cells
24200691 KDMA2 is frequently overexpressed in NSCLC tumors & cell lines. It is needed for in vitro proliferation & invasion. KDM2A activated ERK1/2 by epigenetic repression of DUSP3 expression via demethylation of dimethylated H3K36 at the DUSP3 locus.
More...

AA Sequence

MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRG      1 - 70
GLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKL     71 - 140
YNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTD    141 - 210
FHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPS    211 - 280
GWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHL    281 - 350
TKEFQKESLSMDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT    351 - 420
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIA    421 - 490
DVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPI    491 - 560
VSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNE    561 - 630
ETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAK    631 - 700
VLRPLRSCDEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATER    701 - 770
TMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC    771 - 840
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRREL    841 - 910
CECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLK    911 - 980
DLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLD    981 - 1050
ITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIAN   1051 - 1120
VTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS                               1121 - 1162
//

Text Mined References (49)

PMID Year Title
26416883 2015 Mild Glucose Starvation Induces KDM2A-Mediated H3K36me2 Demethylation through AMPK To Reduce rRNA Transcription and Cell Proliferation.
26207617 2016 Integrated genomic and functional analyses of histone demethylases identify oncogenic KDM2A isoform in breast cancer.
26037310 2015 Fbxl11 Is a Novel Negative Element of the Mammalian Circadian Clock.
26004508 2015 Kdm2a/b Lysine Demethylases Regulate Canonical Wnt Signaling by Modulating the Stability of Nuclear ?-Catenin.
25823024 2016 ATM-mediated KDM2A phosphorylation is required for the DNA damage repair.
25245333 2015 Histone demethylase KDM2A promotes tumor cell growth and migration in gastric cancer.
25029110 2014 Mammalian lysine histone demethylase KDM2A regulates E2F1-mediated gene transcription in breast cancer cells.
24553073 2014 CxxC-ZF domain is needed for KDM2A to demethylate histone in rDNA promoter in response to starvation.
24482232 2014 Transcriptional repression of histone deacetylase 3 by the histone demethylase KDM2A is coupled to tumorigenicity of lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...