Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.93
PubTator Score 7.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
osteosarcoma 7950 5.4e-09
tuberculosis 2010 1.7e-08
glioblastoma 5792 5.2e-05
psoriasis 6694 6.7e-05
medulloblastoma, large-cell 6241 1.1e-03
astrocytic glioma 2597 5.7e-03
oligodendroglioma 2850 1.7e-02
ependymoma 4679 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Gout 106 0.0 3.0
Disease Target Count Z-score Confidence
Cataract 3 multiple types 10 4.662 2.3

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 5.7e-03
ependymoma -1.500 2.3e-02
glioblastoma -1.100 5.2e-05
medulloblastoma, large-cell -1.200 1.1e-03
oligodendroglioma -1.100 1.7e-02
osteosarcoma -2.307 5.4e-09
psoriasis -2.100 6.7e-05
tuberculosis 1.300 1.7e-08

Gene RIF (1)

AA Sequence

MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEIEKECEDTSLRQETQRRTSNHGHARKRAKS      1 - 70
NSKLKLVRSLAVCEESSTPFADGPLETQDIIQLHISCPSDKEEEKSTKDVSEKEDKDKNKEKIPRKMLSR     71 - 140
DSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAY    141 - 210
FGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILKRDDASMDRDDNQTGQNGYLNDI    211 - 280
RLSKEAFSSSSHKRRQIFRGNREGLSRTSSSRQSSTDSELKSLEPRPWSSTDSDGSVRSMRPPVTKASSF    281 - 350
SGISILTRGDSIGSSKGGSAGRISRPGMALGAPEVCNQVTSSQSVRGLLPCTAQQQQQQQQQQLPALPPT    351 - 420
PQQQPPLNNHMISQADDLSNPFGQMSLSRQGSTEAADPSAALFQTPLISQHPQQTSFIMASTGQPLPTSN    421 - 490
YSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPVAYSPQRGQQLPQPSQQPGLQ    491 - 560
PMMPNQQQAAYQGMIGVQQPQNQGLLSSQRSSMGGQMQGLVVQYTPLPSYQVPVGSDSQNVVQPPFQQPM    561 - 630
LVPVSQSVQGGLPAAGVPVYYSMIPPAQQNGTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMPQQYSGVSP    631 - 700
SGPGVVVMQLNVPNGPQPPQNPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSP    701 - 770
APSPVTSLSSVCTGLSPLPVLTQFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQGQSGL    771 - 840
KHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGAKIQWLKDAQGLPGGG    841 - 910
GGDNSGTAENGRHSDLAALYTIVAVFPSPLAAQNASLRLNNSVSRFKLRMAKKNYDLRILERASSQ        911 - 976
//

Text Mined References (19)

PMID Year Title