Property Summary

Ligand Count 3
NCBI Gene PubMed Count 33
PubMed Score 18.17
PubTator Score 4.16

Knowledge Summary

Patent (11,961)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.400 1.1e-02
atypical teratoid / rhabdoid tumor -1.500 8.8e-05
Breast cancer -1.100 2.9e-05
Down syndrome 1.200 4.7e-03
ependymoma -1.300 3.9e-11
glioblastoma -1.200 6.2e-06
hepatocellular carcinoma -1.400 5.9e-05
lung cancer 1.100 3.9e-02
medulloblastoma -1.100 1.5e-03
medulloblastoma, large-cell -1.100 4.6e-04
Multiple myeloma 1.067 2.0e-03
osteosarcoma -1.840 4.0e-05
ovarian cancer -1.100 1.6e-08
Pick disease -1.300 5.9e-04
primitive neuroectodermal tumor -1.100 6.1e-05
psoriasis -2.000 1.3e-04
subependymal giant cell astrocytoma -1.845 1.7e-02
tuberculosis and treatment for 3 months -1.100 1.2e-06

Gene RIF (14)

AA Sequence

MPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRL      1 - 70
YQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDA     71 - 140
NLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTL    141 - 210
QNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKE    211 - 280
ERQVDPLNEDVLLAMEDMGLDKEQTLQSLRSDAYDHYSAIYSLLCDRHKRHKTLRLGALPSMPRALAFQA    281 - 350
PVNIQAEQAGTAMNISVPQVQLINPENQIVEPDGTLNLDSDEGEEPSPEALVRYLSMRRHTVGVADPRTE    351 - 420
VMEDLQKLLPGFPGVNPQAPFLQVAPNVNFMHNLLPMQNLQPTGQLEYKEQSLLQPPTLQLLNGMGPLGR    421 - 490
RASDGGANIQLHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKDSNTLHLPTER    491 - 560
FSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQ    561 - 630
ILQQQIQDSICPPQPSPPLQAACENQPALLTHQLQRLRIQPSSPPPNHPNNHLFRQPSNSPPPMSSAMIQ    631 - 700
PHGAASSSQFQGLPSRSAIFQQQPENCSSPPNVALTCLGMQQPAQSQQVTIQVQEPVDMLSNMPGTAAGS    701 - 770
SGRGISISPSAGQMQMQHRTNLMATLSYGHRPLSKQLSADSAEAHSLNVNRFSPANYDQAHLHPHLFSDQ    771 - 840
SRGSPSSYSPSTGVGFSPTQALKVPPLDQFPTFPPSAHQQPPHYTTSALQQALLSPTPPDYTRHQQVPHI    841 - 910
LQGLLSPRHSLTGHSDIRLPPTEFAQLIKRQQQQRQQQQQQQQQQEYQELFRHMNQGDAGSLAPSLGGQS    911 - 980
MTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPPHGYAHQPALMHSESMEEDCSCEGAKDGF    981 - 1050
QDSKSSSTLTKGCHDSPLLLSTGGPGDPESLLGTVSHAQELGIHPYGHQPTAAFSKNKVPSREPVIGNCM   1051 - 1120
DRSSPGQAVELPDHNGLGYPARPSVHEHHRPRALQRHHTIQNSDDAYVQLDNLPGMSLVAGKALSSARMS   1121 - 1190
DAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPSTCITDILLSYKHPEVSFSMEQ   1191 - 1260
AGV                                                                      1261 - 1263
//

Text Mined References (40)

PMID Year Title