Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
R01 Count 4
Funding $252,384
PubMed Score 15.11
PubTator Score 4.16

Knowledge Summary

Patent (11,961)

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
Multiple myeloma 1.067 0.002
psoriasis -2.000 0.000
osteosarcoma -1.840 0.000
posterior fossa group A ependymoma -1.400 0.000
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.100 0.000
tuberculosis and treatment for 3 months -1.100 0.000
lung cancer 1.100 0.039
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -2.846 0.005
Pick disease -1.300 0.001
Breast cancer -1.200 0.000
ovarian cancer -1.900 0.000
Down syndrome 1.200 0.005

Synonym

Accession Q9Y2K2 A1A5A8 Q59FY2 Q5M9N1 Q6P3R6 Q8IYM8 Q9HA50
Symbols L19
QSK
SIK-3

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (10)

PMID Text
27009967 SIK3 is activated in human osteoarthritic cartilage.
25060954 Developmental role of Sik3 in hearing and requirement for the maintenance of adult auditory function is reported.
24886709 SIK3 variants were associated with hypertriglyceridemia in Mexicans.
24743732 These results establish the importance of SIK3 as a mitotic regulator and underscore the potential of SIK3 as a druggable antimitotic target.
23393134 tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases
22588126 cAMP-mediated regulation of SIK3 suggest that SIK3 may mediate some of the effects of this important second messenger in adipocytes
21399663 Overexpression of SIK3 promotes G1/S cell cycle progression, bestows survival advantages to cancer cells for growth and correlates the clinicopathological conditions of patients with ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18266979 Fecal ribosomal protein L19 is a genetic prognostic factor for survival in colorectal cancer.

AA Sequence

MPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRL      1 - 70
YQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDA     71 - 140
NLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTL    141 - 210
QNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQQLKE    211 - 280
ERQVDPLNEDVLLAMEDMGLDKEQTLQSLRSDAYDHYSAIYSLLCDRHKRHKTLRLGALPSMPRALAFQA    281 - 350
PVNIQAEQAGTAMNISVPQVQLINPENQIVEPDGTLNLDSDEGEEPSPEALVRYLSMRRHTVGVADPRTE    351 - 420
VMEDLQKLLPGFPGVNPQAPFLQVAPNVNFMHNLLPMQNLQPTGQLEYKEQSLLQPPTLQLLNGMGPLGR    421 - 490
RASDGGANIQLHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKDSNTLHLPTER    491 - 560
FSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQ    561 - 630
ILQQQIQDSICPPQPSPPLQAACENQPALLTHQLQRLRIQPSSPPPNHPNNHLFRQPSNSPPPMSSAMIQ    631 - 700
PHGAASSSQFQGLPSRSAIFQQQPENCSSPPNVALTCLGMQQPAQSQQVTIQVQEPVDMLSNMPGTAAGS    701 - 770
SGRGISISPSAGQMQMQHRTNLMATLSYGHRPLSKQLSADSAEAHSLNVNRFSPANYDQAHLHPHLFSDQ    771 - 840
SRGSPSSYSPSTGVGFSPTQALKVPPLDQFPTFPPSAHQQPPHYTTSALQQALLSPTPPDYTRHQQVPHI    841 - 910
LQGLLSPRHSLTGHSDIRLPPTEFAQLIKRQQQQRQQQQQQQQQQEYQELFRHMNQGDAGSLAPSLGGQS    911 - 980
MTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPPHGYAHQPALMHSESMEEDCSCEGAKDGF    981 - 1050
QDSKSSSTLTKGCHDSPLLLSTGGPGDPESLLGTVSHAQELGIHPYGHQPTAAFSKNKVPSREPVIGNCM   1051 - 1120
DRSSPGQAVELPDHNGLGYPARPSVHEHHRPRALQRHHTIQNSDDAYVQLDNLPGMSLVAGKALSSARMS   1121 - 1190
DAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPSTCITDILLSYKHPEVSFSMEQ   1191 - 1260
AGV                                                                      1261 - 1263
//

Text Mined References (36)

PMID Year Title
27009967 2016 Pterosin B prevents chondrocyte hypertrophy and osteoarthritis in mice by inhibiting Sik3.
25416956 2014 A proteome-scale map of the human interactome network.
25060954 2014 Salt-inducible kinase 3, SIK3, is a new gene associated with hearing.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24743732 2014 Salt-inducible kinase 3 is a novel mitotic regulator and a target for enhancing antimitotic therapeutic-mediated cell death.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23393134 2013 The tumor suppressor kinase LKB1 activates the downstream kinases SIK2 and SIK3 to stimulate nuclear export of class IIa histone deacetylases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
More...