Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.75
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.158 7.7e-06
Down syndrome 1.100 3.3e-03
gastric cancer 1.300 5.1e-03
glioblastoma 1.100 6.8e-03
intraductal papillary-mucinous adenoma (... 1.200 9.9e-03
intraductal papillary-mucinous carcinoma... 1.200 8.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 8.3e-03
lung cancer -1.100 1.0e-02
malignant mesothelioma -1.100 1.9e-05
Multiple myeloma 1.918 5.1e-04
osteosarcoma 1.368 2.5e-04
ovarian cancer -1.900 5.4e-07
progressive supranuclear palsy -1.100 8.5e-03
psoriasis -1.600 2.3e-02
Rheumatoid arthritis 1.500 5.4e-03
sarcoidosis 1.300 2.4e-02
sonic hedgehog group medulloblastoma 1.300 5.7e-04
tuberculosis -2.000 5.6e-06

Gene RIF (2)

AA Sequence

MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKI      1 - 70
SAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSSKCSSSASSKQNSKMIF     71 - 140
GVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREADEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSR    141 - 210
RFGRSFTCDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQ    211 - 280
TDKYRGDTSQAADDSASTTGSRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDK    281 - 350
DCNESTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDAEN    351 - 420
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDL    421 - 490
EENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQD    491 - 560
MFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKG    561 - 630
MARYVCSICDQGNFRKHDHVRHMISHLSAGETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKD    631 - 700
MRSHYNAKHLKRT                                                             701 - 713
//

Text Mined References (20)

PMID Year Title