Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.01
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 5.41818267670927E-7
tuberculosis 1563 5.57547930750917E-6
Amyotrophic Lateral Sclerosis 432 7.7320313759256E-6
malignant mesothelioma 3163 1.93117222491783E-5
osteosarcoma 7933 2.53912022097617E-4
psoriasis 6685 3.86699504290447E-4
Multiple myeloma 1328 5.10700913326224E-4
sonic hedgehog group medulloblastoma 1482 5.72278651314579E-4
Down syndrome 548 0.00334894408165014
gastric cancer 436 0.00508457625615167
Rheumatoid Arthritis 1171 0.00544427707270599
glioblastoma 5572 0.0068310876657148
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00829418160081109
progressive supranuclear palsy 674 0.00852182241752262
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00868324307553254
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00993838616017605
lung cancer 4473 0.00998304895368808
sarcoidosis 368 0.0241705538058082
Disease Target Count Z-score Confidence
T cell deficiency 7 4.475 2.2

Expression

  Differential Expression (18)

Synonym

Accession Q9Y2K1 A8K6S8 Q86SW8
Symbols ZNF909

Gene

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
24657165 ZBTB1 is required for localizing phospho-KAP-1 to chromatin and enhancing RAD18 accessibility during chromatin remodeling/DNA repair.
21706167 ZBTB1 protein may act as a transcription repressor in the activation of CREB and cAMP-mediated signal transduction pathways to mediate cellular functions.

AA Sequence

MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKI      1 - 70
SAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSSKCSSSASSKQNSKMIF     71 - 140
GVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREADEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSR    141 - 210
RFGRSFTCDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQ    211 - 280
TDKYRGDTSQAADDSASTTGSRKSSTVESEIASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDK    281 - 350
DCNESTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSVSADERGGLENMRPPNNSSPVQEDAEN    351 - 420
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDL    421 - 490
EENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVEHMSSCLDQD    491 - 560
MFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKG    561 - 630
MARYVCSICDQGNFRKHDHVRHMISHLSAGETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKD    631 - 700
MRSHYNAKHLKRT                                                             701 - 713
//

Text Mined References (19)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24657165 2014 Transcriptional repressor ZBTB1 promotes chromatin remodeling and translesion DNA synthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22753936 2012 Transcription factor zinc finger and BTB domain 1 is essential for lymphocyte development.
21706167 2011 Novel human BTB/POZ domain-containing zinc finger protein ZBTB1 inhibits transcriptional activities of CRE.
20797634 2010 Site-specific identification of SUMO-2 targets in cells reveals an inverted SUMOylation motif and a hydrophobic cluster SUMOylation motif.
More...