Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.96
PubTator Score 9.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis 1.230 3.0e-02
Breast cancer -1.100 6.6e-06
breast carcinoma -1.400 1.2e-04
ductal carcinoma in situ -1.800 1.4e-05
fibroadenoma -1.400 1.5e-02
group 3 medulloblastoma 1.100 5.3e-03
intraductal papillary-mucinous carcinoma... -1.300 1.0e-02
invasive ductal carcinoma -2.400 1.9e-04
lung adenocarcinoma -1.300 3.3e-08
lung cancer -1.400 2.5e-03
ovarian cancer -1.800 3.0e-08
spina bifida -2.059 3.0e-02

Gene RIF (11)

AA Sequence

MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAPEDSQVLQQAT      1 - 70
RQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGTRPHAGDRDPRGAPGGS     71 - 140
RRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSSSHSFPQLARNQQGPPLRGPPAEGPESRGPP    141 - 210
PQYPHVVLAHETTTAVTDPRYRARGSPHFQHAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAAL    211 - 280
GHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLES    281 - 350
EIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMV    351 - 420
AKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQAYVEKVERLQ    421 - 490
QALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQIL    491 - 560
ALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLK    561 - 630
VLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLT    631 - 700
TDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQD    701 - 770
LSDMVEILI                                                                 771 - 779
//

Text Mined References (32)

PMID Year Title