Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.50
PubTator Score 9.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.300 0.010
lung cancer -1.400 0.002
active ulcerative colitis 1.230 0.030
breast carcinoma -1.400 0.000
fibroadenoma -1.400 0.015
group 3 medulloblastoma 1.100 0.005
lung adenocarcinoma -1.300 0.000
non-inflammatory breast cancer -1.200 0.004
spina bifida -2.059 0.030
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.400 0.000
ovarian cancer 2.000 0.000

Gene RIF (11)

PMID Text
26598551 study reports for the first time that USP9X is a deubiquitinase of Angiomotin-like 2 (AMOTL2) and that AMOTL2 mono-ubiquitination is required for YAP inhibition
25998128 mTORC2-mediated phosphorylation of AMOTL2 blocks its ability to inhibit YAP signaling.
25633977 Knockdown of Angiomotin (AMOT) by siRNA inhibits HIV-1 release and infectivity, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25633977 Knockdown of Angiomotin (AMOT) by siRNA inhibits HIV-1 release and infectivity, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25080976 AmotL2 expression correlates with loss of tissue architecture in tumors from human breast and colon cancer patients.
24225952 These results collectively suggest that the Hippo pathway negatively regulates the actin-binding activity of Amot family members through direct phosphorylation.
24003252 Scaffold proteins angiomotin (Amot) and angiomotin-related AmotL1 and AmotL2 were recently identified as negative regulators of YAP and TAZ by preventing their nuclear translocation.
23911299 AMOTL2 interacts with TAZ and modulates transcriptional activity of TAZ.
23525008 These results demonstrate a role for Amotl2 in synaptic maturation and support the involvement of podosomes in this process.
21937427 Amotl2 plays a pivotal role in polarity, migration and proliferation of angiogenic endothelial cells
More...

AA Sequence

MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAPEDSQVLQQAT      1 - 70
RQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGTRPHAGDRDPRGAPGGS     71 - 140
RRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSSSHSFPQLARNQQGPPLRGPPAEGPESRGPP    141 - 210
PQYPHVVLAHETTTAVTDPRYRARGSPHFQHAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAAL    211 - 280
GHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLES    281 - 350
EIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMV    351 - 420
AKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQAYVEKVERLQ    421 - 490
QALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQIL    491 - 560
ALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLK    561 - 630
VLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLT    631 - 700
TDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQD    701 - 770
LSDMVEILI                                                                 771 - 779
//

Text Mined References (28)

PMID Year Title
26598551 2016 Role of Angiomotin-like 2 mono-ubiquitination on YAP inhibition.
25998128 2015 Phosphorylation of the Hippo Pathway Component AMOTL2 by the mTORC2 Kinase Promotes YAP Signaling, Resulting in Enhanced Glioblastoma Growth and Invasiveness.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25080976 2014 AmotL2 disrupts apical-basal cell polarity and promotes tumour invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24225952 2013 Actin-binding and cell proliferation activities of angiomotin family members are regulated by Hippo pathway-mediated phosphorylation.
24003252 2013 Angiomotin'g YAP into the nucleus for cell proliferation and cancer development.
23911299 2013 AMOTL2 interaction with TAZ causes the inhibition of surfactant proteins expression in lung cells.
More...