Property Summary

NCBI Gene PubMed Count 62
PubMed Score 116.18
PubTator Score 66.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
glioblastoma multiforme 347 2.83130664830827E-12
oligodendroglioma 2849 7.13065409246136E-11
non-small cell lung cancer 2798 5.41317950896575E-10
ovarian cancer 8492 1.43711467638319E-9
malignant mesothelioma 3163 4.75093951432402E-9
Duchenne muscular dystrophy 602 6.3321979289374E-9
lung adenocarcinoma 2714 4.97540693950831E-7
atypical teratoid / rhabdoid tumor 4369 5.65252325110363E-7
tuberculosis and treatment for 3 months 327 9.23996515122527E-7
Amyotrophic Lateral Sclerosis 432 9.32544126509279E-6
pituitary cancer 1972 1.79470621455987E-5
adult high grade glioma 2148 4.42084192139706E-5
cystic fibrosis 1670 1.21663548248442E-4
primary Sjogren syndrome 789 1.86601058215951E-4
ulcerative colitis 2087 2.35492177613793E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.17745579386391E-4
breast carcinoma 1614 0.00142229936341818
psoriasis 6685 0.00196329098809395
lung cancer 4473 0.003454469547708
nasopharyngeal carcinoma 1056 0.0034714086415593
adrenocortical carcinoma 1427 0.0045685619815729
osteosarcoma 7933 0.00493708878845734
urothelial carcinoma 318 0.00555790174181881
sonic hedgehog group medulloblastoma 1482 0.00573766565573229
colon cancer 1475 0.00583216173519345
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00587007597846688
astrocytic glioma 2241 0.00645341339080907
Pick disease 1893 0.00845591455654131
diabetes mellitus 1663 0.00919308568856256
facioscapulohumeral dystrophy 286 0.00956865731547657
subependymal giant cell astrocytoma 2287 0.0182766523444121
ependymoma 2514 0.0197462848121689
nephrosclerosis 329 0.0209104436930646
Gaucher disease type 1 171 0.0238011741140556
gastric carcinoma 832 0.0251720483400966
primitive neuroectodermal tumor 3031 0.0301794151901365
aldosterone-producing adenoma 664 0.0480506987944655
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9Y2J2 B7Z4I5 F5GX05 O95713 Q9BRP5
Symbols 4.1B
DAL1
DAL-1

Gene

PDB

3BIN   2HE7  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (38)

PMID Text
26300315 Downregulation of DAL-1/4.1B expression effectively suppresses DAL-1/4.1B protein expression in lung cancer cells.
25881295 Our study demonstrates for the first time that platelet-secreted miR-223 via P-MVs can promote lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 a central role of CADM1 in stabilizing the complex with 4.1B and MPP3
25631074 Cellular biotinylated erythrocyte membrane protein band 4.1-like 3 (EPB41L3) protein is incorporated into HIV-1 Gag virus-like particles
25621889 We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas
25609022 The results suggest that tumor suppressor DAL-1 could also attenuate epithelial-to mesenchymal transition and be important for tumor metastasis in the early transformation process in lung cancer.
25183197 Studies indicate that tumor suppressor protein 4.1B/DAL-1 plays a crucial regulatory role in cell growth and differentiation.
24828608 In granulosa cells, there are significant changes in expression during follicular maturation.
22782504 Loss of expression of the differentially expressed in adenocarcinoma of the lung protein is associated with metastasis of non-small cell lung carcinoma.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
More...

AA Sequence

MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRREVTDKEQEFA      1 - 70
ARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVC     71 - 140
EHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLR    141 - 210
DDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPA    211 - 280
EAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIK    281 - 350
IRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS    351 - 420
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEE    421 - 490
VTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLPGYEPSRAEHLPGEPALDSDG    491 - 560
PGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSP    561 - 630
SLVPCFLFIFFFLLSASFSVPYALTLSFPLALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAAD    631 - 700
GETTATESDQEEDAELKAQELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQ    701 - 770
EDAPMIEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT    771 - 840
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVA    841 - 910
KAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHT    911 - 980
ETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHD    981 - 1050
QALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED                                    1051 - 1087
//

Text Mined References (70)

PMID Year Title
26300315 2015 DAL-1/4.1B contributes to epithelial-mesenchymal transition via regulation of transforming growth factor-? in lung cancer cell lines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25881295 2015 MicroRNA-223 delivered by platelet-derived microvesicles promotes lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 2015 Dynamic regulation of a cell adhesion protein complex including CADM1 by combinatorial analysis of FRAP with exponential curve-fitting.
25621889 2015 EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.
25609022 2015 DAL-1 attenuates epithelial-to mesenchymal transition in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25183197 2014 Tumor suppressor role of protein 4.1B/DAL-1.
24828608 2014 Differential expression of poliovirus receptor, regulator of G-protein signaling 11 and erythrocyte protein band 4.1-like 3 in human granulosa cells during follicular growth and maturation.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
More...