Property Summary

NCBI Gene PubMed Count 65
PubMed Score 121.63
PubTator Score 66.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8

Expression

  Differential Expression (37)

Disease log2 FC p
adrenocortical carcinoma -1.576 4.6e-03
adult high grade glioma -2.700 4.4e-05
aldosterone-producing adenoma -1.104 4.8e-02
Amyotrophic lateral sclerosis 1.005 9.3e-06
astrocytic glioma -2.100 6.5e-03
atypical teratoid / rhabdoid tumor -3.000 5.7e-07
breast carcinoma -1.100 1.4e-03
colon cancer -1.500 3.3e-02
cystic fibrosis 1.170 1.2e-04
diabetes mellitus -1.300 9.2e-03
Duchenne muscular dystrophy 1.032 6.3e-09
ependymoma -2.200 2.0e-02
facioscapulohumeral dystrophy 2.000 9.6e-03
gastric carcinoma 1.400 2.5e-02
Gaucher disease type 1 2.200 2.4e-02
glioblastoma -1.600 2.5e-04
group 3 medulloblastoma -1.200 3.9e-02
intraductal papillary-mucinous adenoma (... -2.700 5.2e-04
intraductal papillary-mucinous carcinoma... -2.400 5.9e-03
lung adenocarcinoma -1.100 5.0e-07
lung cancer -2.000 3.5e-03
malignant mesothelioma 6.600 1.2e-09
nasopharyngeal carcinoma 1.100 6.0e-03
nephrosclerosis -1.432 2.1e-02
non-small cell lung cancer -1.196 5.4e-10
oligodendroglioma -1.700 7.1e-11
osteosarcoma 1.918 4.9e-03
ovarian cancer -2.700 1.0e-09
Pick disease -1.600 8.5e-03
pituitary cancer 1.100 1.8e-05
primary Sjogren syndrome 1.600 1.9e-04
primitive neuroectodermal tumor -1.700 3.0e-02
psoriasis 1.600 2.0e-03
subependymal giant cell astrocytoma -1.663 1.9e-02
tuberculosis -2.800 1.4e-07
ulcerative colitis -1.600 2.4e-04
urothelial carcinoma -3.100 5.6e-03

Gene RIF (41)

AA Sequence

MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRREVTDKEQEFA      1 - 70
ARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVC     71 - 140
EHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLR    141 - 210
DDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPA    211 - 280
EAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIK    281 - 350
IRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS    351 - 420
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEE    421 - 490
VTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLPGYEPSRAEHLPGEPALDSDG    491 - 560
PGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSP    561 - 630
SLVPCFLFIFFFLLSASFSVPYALTLSFPLALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAAD    631 - 700
GETTATESDQEEDAELKAQELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQ    701 - 770
EDAPMIEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT    771 - 840
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVA    841 - 910
KAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHT    911 - 980
ETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHD    981 - 1050
QALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED                                    1051 - 1087
//

Text Mined References (73)

PMID Year Title