Property Summary

NCBI Gene PubMed Count 62
Grant Count 33
R01 Count 17
Funding $2,595,801.28
PubMed Score 116.18
PubTator Score 66.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

PMID Text
26300315 Downregulation of DAL-1/4.1B expression effectively suppresses DAL-1/4.1B protein expression in lung cancer cells.
25881295 Our study demonstrates for the first time that platelet-secreted miR-223 via P-MVs can promote lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 a central role of CADM1 in stabilizing the complex with 4.1B and MPP3
25631074 Cellular biotinylated erythrocyte membrane protein band 4.1-like 3 (EPB41L3) protein is incorporated into HIV-1 Gag virus-like particles
25621889 We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas
25609022 The results suggest that tumor suppressor DAL-1 could also attenuate epithelial-to mesenchymal transition and be important for tumor metastasis in the early transformation process in lung cancer.
25183197 Studies indicate that tumor suppressor protein 4.1B/DAL-1 plays a crucial regulatory role in cell growth and differentiation.
24828608 In granulosa cells, there are significant changes in expression during follicular maturation.
22782504 Loss of expression of the differentially expressed in adenocarcinoma of the lung protein is associated with metastasis of non-small cell lung carcinoma.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
More...

AA Sequence

MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRREVTDKEQEFA      1 - 70
ARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVC     71 - 140
EHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLR    141 - 210
DDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPA    211 - 280
EAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIK    281 - 350
IRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS    351 - 420
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEEDKRRKGEE    421 - 490
VTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLPGYEPSRAEHLPGEPALDSDG    491 - 560
PGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSP    561 - 630
SLVPCFLFIFFFLLSASFSVPYALTLSFPLALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAAD    631 - 700
GETTATESDQEEDAELKAQELEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQ    701 - 770
EDAPMIEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT    771 - 840
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVA    841 - 910
KAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGSVSPGGVKLEISTKEVPVVHT    911 - 980
ETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHD    981 - 1050
QALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED                                    1051 - 1087
//

Text Mined References (70)

PMID Year Title
26300315 2015 DAL-1/4.1B contributes to epithelial-mesenchymal transition via regulation of transforming growth factor-? in lung cancer cell lines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25881295 2015 MicroRNA-223 delivered by platelet-derived microvesicles promotes lung cancer cell invasion via targeting tumor suppressor EPB41L3.
25780926 2015 Dynamic regulation of a cell adhesion protein complex including CADM1 by combinatorial analysis of FRAP with exponential curve-fitting.
25621889 2015 EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.
25609022 2015 DAL-1 attenuates epithelial-to mesenchymal transition in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25183197 2014 Tumor suppressor role of protein 4.1B/DAL-1.
24828608 2014 Differential expression of poliovirus receptor, regulator of G-protein signaling 11 and erythrocyte protein band 4.1-like 3 in human granulosa cells during follicular growth and maturation.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
More...