Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.38
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.000 0.011
ependymoma -2.500 0.010
oligodendroglioma -1.800 0.005
esophageal adenocarcinoma 1.200 0.038
glioblastoma -3.100 0.000
osteosarcoma 1.296 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
primitive neuroectodermal tumor -1.500 0.018
lung cancer 2.400 0.000
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.500 0.000
subependymal giant cell astrocytoma -2.085 0.009
lung carcinoma 3.000 0.000
Pick disease -1.100 0.040
ductal carcinoma in situ 1.300 0.007
invasive ductal carcinoma 1.700 0.007
pituitary cancer -1.400 0.000

Synonym

Accession Q9Y2I9 B3KP01 B9A6M9 E7EMW4 F5GYJ9
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MDVLPTGGGRPGLRTELEFRGGGGEARLESQEEETIPAAPPAPRLRGAAERPRRSRDTWDGDEDTEPGEA      1 - 70
CGGRTSRTASLVSGLLNELYSCTEEEEAAGGGRGAEGRRRRRDSLDSSTEASGSDVVLGGRSGAGDSRVL     71 - 140
QELQERPSQRHQMLYLRQKDANELKTILRELKYRIGIQSAKLLRHLKQKDRLLHKVQRNCDIVTACLQAV    141 - 210
SQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRF    211 - 280
TFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILE    281 - 350
VMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQHLDTLQRTANKESGGGY    351 - 420
EPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMG    421 - 490
RLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPFPATVKPTSVSGRHSKARDSDEEND    491 - 560
PDDEDAVVNAVGCLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMM    561 - 630
ERMTTDINALKRQYSRIKKKQQQQVHQVYIRADKGPVTSILPSQVNSSPVINHLLLGKKMKMTNRAAKNA    631 - 700
VIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLGAA    701 - 770
EAFPSGCTATAGREGSSPEGSTRRTIEGQSPEPVFGDADVDVSAVQAKLGALELNQRDAAAETELRVHPP    771 - 840
CQRHCPEPPSAPEENKATSKAPQGSNSKTPIFSPFPSVKPLRKSATARNLGLYGPTERTPTVHFPQMSRS    841 - 910
FSKPGGGNSGTKKR                                                            911 - 924
//

Text Mined References (8)

PMID Year Title
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
17646400 2007 Functional dissection of Rab GTPases involved in primary cilium formation.
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12618308 2003 GAPs galore! A survey of putative Ras superfamily GTPase activating proteins in man and Drosophila.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.