Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.36
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.600 6.4e-04
astrocytic glioma -1.700 2.3e-03
Astrocytoma, Pilocytic -2.100 1.1e-09
atypical teratoid / rhabdoid tumor -2.500 3.8e-08
ductal carcinoma in situ 1.300 7.0e-03
ependymoma -2.300 7.8e-04
esophageal adenocarcinoma 1.200 3.8e-02
glioblastoma -2.200 6.7e-10
invasive ductal carcinoma 1.700 7.1e-03
lung cancer 2.100 6.7e-03
lung carcinoma 3.000 1.9e-32
oligodendroglioma -1.800 5.3e-03
osteosarcoma 1.296 8.0e-07
Pick disease -1.100 4.0e-02
pituitary cancer -1.400 7.0e-06
primitive neuroectodermal tumor -1.400 3.2e-02
subependymal giant cell astrocytoma -2.085 9.3e-03

AA Sequence

MDVLPTGGGRPGLRTELEFRGGGGEARLESQEEETIPAAPPAPRLRGAAERPRRSRDTWDGDEDTEPGEA      1 - 70
CGGRTSRTASLVSGLLNELYSCTEEEEAAGGGRGAEGRRRRRDSLDSSTEASGSDVVLGGRSGAGDSRVL     71 - 140
QELQERPSQRHQMLYLRQKDANELKTILRELKYRIGIQSAKLLRHLKQKDRLLHKVQRNCDIVTACLQAV    141 - 210
SQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRF    211 - 280
TFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILE    281 - 350
VMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQHLDTLQRTANKESGGGY    351 - 420
EPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMG    421 - 490
RLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPFPATVKPTSVSGRHSKARDSDEEND    491 - 560
PDDEDAVVNAVGCLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMM    561 - 630
ERMTTDINALKRQYSRIKKKQQQQVHQVYIRADKGPVTSILPSQVNSSPVINHLLLGKKMKMTNRAAKNA    631 - 700
VIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLGAA    701 - 770
EAFPSGCTATAGREGSSPEGSTRRTIEGQSPEPVFGDADVDVSAVQAKLGALELNQRDAAAETELRVHPP    771 - 840
CQRHCPEPPSAPEENKATSKAPQGSNSKTPIFSPFPSVKPLRKSATARNLGLYGPTERTPTVHFPQMSRS    841 - 910
FSKPGGGNSGTKKR                                                            911 - 924
//

Text Mined References (8)

PMID Year Title