Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 2
Funding $235,996.25
PubMed Score 52.45
PubTator Score 178.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

 IMPC Term (1)

Gene RIF (13)

PMID Text
26805762 Upon UVC radiation, Nlp interacts with XPA and ERCC1, and enhances their association
26485645 these data support a model where CC2D2A associates with NINL to provide a docking point for cilia-directed cargo vesicles, suggesting a mechanism by which transition zone proteins can control the protein content of the ciliary compartment.
22353935 Breast cancer patients with high expression of Nlp were likely resistant to the treatment of paclitaxel.
21505454 This review summarises our current knowledge of physiological roles of Nlp, with an emphasis on its potentials in tumourigenesis.
20890132 findings demonstrate that Cdc2/cyclin B1 is a key regulator in maintaining appropriate degradation and subcellular localization of Nlp, providing novel insights into understanding on the role of Cdc2/cyclin B1 in mitotic progression
20864540 regulation of Nlp by Aurora B is critical for the completion of cytokinesis, providing novel insights into understanding the machinery of cell cycle progression.
20093778 Nlp abnormalities may contribute to genomic instability and tumorigenesis and might serve as a potential biomarker for clinical diagnosis and as a therapeutic target.
19724857 Nlp overexpression might contribute to the development of head and neck squamous cell carcinoma
19509300 BRCA1 interaction of Nlp might be required for the successful mitotic progression, and abnormalities of Nlp lead to genomic instability.
18826961 Nlp(isoB)interacts with USH2A and lebercilin.
More...

AA Sequence

MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFARVNFEEFKEGF      1 - 70
VAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDAATEARRVPEQQTQASLKSHL     71 - 140
WRSASLESVESPKSDEEAESTKEAQNELFEAQGQLQTWDSEDFGSPQKSCSPSFDTPESQIRGVWEELGV    141 - 210
GSSGHLSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPS    211 - 280
KAWSHYQVPEESGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSV    281 - 350
DEKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARERDKARQDLERAEKRNLEFVKE    351 - 420
MDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEAERELFWEQAHRQRAALEWDVGRLQAEEAGLREKL    421 - 490
TLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKDKLEPQSAELLAQEERFAAVLKEYELKCRD    491 - 560
LQDRNDELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGLGPAGISFLGNSAPVSIETELMMEQVKEHYQ    561 - 630
DLRTQLETKVNYYEREIAALKRNFEKERKDMEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQDT    631 - 700
ARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLP    701 - 770
RGSQRSEQLELERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQ    771 - 840
EGTRGLLPLRPGCGERPLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQ    841 - 910
PCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCRGQAERLQAIQE    911 - 980
ERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRGSLPSHLQLADPQGSWQEQLAAPEEGETKIA    981 - 1050
LEREKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKE   1051 - 1120
IEVLKKDKEKACSEMEVLNRQNQNYKDQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRS   1121 - 1190
GQQQSDQIQKLRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVA   1191 - 1260
ELHRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLL   1261 - 1330
KELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAALSV                     1331 - 1382
//

Text Mined References (28)

PMID Year Title
26805762 2016 Mitotic regulator Nlp interacts with XPA/ERCC1 complexes and regulates nucleotide excision repair (NER) in response to UV radiation.
26485645 2015 The Ciliopathy Protein CC2D2A Associates with NINL and Functions in RAB8-MICAL3-Regulated Vesicle Trafficking.
25416956 2014 A proteome-scale map of the human interactome network.
22353935 2012 Overexpression of centrosomal protein Nlp confers breast carcinoma resistance to paclitaxel.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21505454 2011 The role of centrosomal Nlp in the control of mitotic progression and tumourigenesis.
20890132 2010 Cdc2/cyclin B1 regulates centrosomal Nlp proteolysis and subcellular localization.
20864540 2010 Aurora B interaction of centrosomal Nlp regulates cytokinesis.
20093778 2010 Centrosomal Nlp is an oncogenic protein that is gene-amplified in human tumors and causes spontaneous tumorigenesis in transgenic mice.
19724857 2009 Ninein-like protein is overexpressed in head and neck squamous cell carcinoma and contributes to cancer growth and resistance to apoptosis.
More...