Property Summary

NCBI Gene PubMed Count 30
PubMed Score 12.37
PubTator Score 23.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.100 0.008
ependymoma -3.100 0.000
oligodendroglioma -1.500 0.004
glioblastoma -2.000 0.000
group 3 medulloblastoma -3.200 0.000
cystic fibrosis 1.803 0.000
atypical teratoid / rhabdoid tumor -2.100 0.005
medulloblastoma, large-cell -3.700 0.000
non-small cell lung carcinoma -1.300 0.000
interstitial cystitis -1.400 0.043
lung adenocarcinoma -1.200 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma 1.200 0.000
lung carcinoma -1.700 0.000
ovarian cancer -3.000 0.000
pituitary cancer -1.700 0.000

Gene RIF (21)

PMID Text
25325217 examined the hypothesis that NTNG1 allelic variation contributes to the risk for schizophrenia
23986473 Interaction between the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
23769687 Our finding nominates the minor G allele of the NTNG1 rs628117 single nucleotide polymorphism as a risk factor for ischemic stroke at least in Armenian population.
22227940 Genotype and allele frequencies of single nucleotide polymorphisms on NTNG1 are significantly associated with schizophrenia.
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDI      1 - 70
TCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSK     71 - 140
TIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEY    141 - 210
STGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELH    211 - 280
LARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGT    281 - 350
ANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC    351 - 420
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPA    421 - 490
AYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF                         491 - 539
//

Text Mined References (31)

PMID Year Title
25325217 2014 Replication of NTNG1 association in schizophrenia.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23986473 2013 Trans-induced cis interaction in the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
23769687 2013 The netrin G1 gene rs628117 polymorphism is associated with ischemic stroke.
22227940 2011 Positive association between NTNG1 and schizophrenia in Chinese Han population.
21946559 2011 Structural basis for cell surface patterning through NetrinG-NGL interactions.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
More...