Property Summary

NCBI Gene PubMed Count 30
PubMed Score 11.02
PubTator Score 23.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Schizophrenia 1160 3.059 1.5
Bipolar Disorder 666 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 0.9
Disease Target Count
Atypical Rett syndrome 4

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 3.8e-03
astrocytic glioma -1.100 7.6e-03
Astrocytoma, Pilocytic 1.200 1.7e-05
atypical teratoid / rhabdoid tumor 1.100 6.6e-03
cystic fibrosis 1.157 4.3e-03
ependymoma -1.500 6.9e-03
glioblastoma -2.000 4.4e-05
group 3 medulloblastoma -3.000 5.2e-04
interstitial cystitis -1.400 4.3e-02
lung adenocarcinoma -1.200 7.3e-15
lung carcinoma -1.700 1.3e-15
medulloblastoma, large-cell -3.200 2.6e-05
non-small cell lung cancer -1.005 5.2e-14
oligodendroglioma -1.500 4.2e-03
ovarian cancer -2.800 1.1e-11
pituitary cancer -1.700 5.7e-08

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDI      1 - 70
TCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSK     71 - 140
TIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEY    141 - 210
STGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELH    211 - 280
LARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGT    281 - 350
ANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC    351 - 420
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPA    421 - 490
AYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF                         491 - 539
//

Text Mined References (31)

PMID Year Title