Property Summary

NCBI Gene PubMed Count 31
Grant Count 132
R01 Count 111
Funding $23,256,693.96
PubMed Score 562.72
PubTator Score 227.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma -1.137 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
adult high grade glioma -1.300 0.000
posterior fossa group A ependymoma -1.100 0.000
subependymal giant cell astrocytoma -1.601 0.016
ovarian cancer -2.200 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q9Y2I1 C9J245 Q6PGP3 Q6PIB4 Q7L8M3 Q7Z2X6 Q9UES6 Q9UEU4 Q9UFW3
Symbols I-1
IR1
IRAS
hIRAS

Gene

PANTHER Protein Class (1)

PDB

3P0C  

Gene RIF (20)

PMID Text
25724667 Data found that NISCH was significantly downregulated in ovarian neoplasm through its promotor silencing with hypermethylation and its expression was correlated with poor prognosis.
25695373 Nischarin expression may therefore be used as a marker to predict the invasiveness and metastasis of primary breast cancer
23572524 unctional interaction between LKB1 and Nischarin to inhibit cell migration and breast tumor progression
23503203 Tobacco smoke induces methylation changes in the NISCH gene promoter before any detectable cancer.
22483786 Imidazoline receptor 1 gene plays a role in the development of cardiac hypertrophy and ventirular remodeling.
21917605 Nischarin reduces alpha5 integrin expression leading to reduction of FAK phosphorylation and Rac GTP loading, which in turn reduces tumor growth. NISCH also regulates PAK and LIMK signaling.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18561481 shows strong affinity to clonidine and regulates blood pressure.
More...

AA Sequence

MATARTFGPEREAEPAKEARVVGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKLVAERKIDKNL      1 - 70
LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQL     71 - 140
LGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLP    141 - 210
FDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVT    211 - 280
AVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL    281 - 350
HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDY    351 - 420
RTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSNPEKKGGEDSRLSAAPCIRPSSS    421 - 490
PPTVAPASASLPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQGCSDSLESIPAGQAASDDLRDV    491 - 560
PGAVGGASPEHAEPEVQVVPGSGQIIFLPFTCIGYTATNQDFIQRLSTLIRQAIERQLPAWIEAANQREE    561 - 630
GQGEQGEEEDEEEEEEEDVAENRYFEMGPPDVEEEEGGGQGEEEEEEEEDEEAEEERLALEWALGADEDF    631 - 700
LLEHIRILKVLWCFLIHVQGSIRQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTE    701 - 770
FGFLMPELCLVLKVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLT    771 - 840
FYKVAGGCQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEAVKSAAIPYWL    841 - 910
LLTPQHLNVIKADFNPMPNRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCTQPRGAFADGHVLELLVGYRF    911 - 980
VTAIFVLPHEKFHFLRVYNQLRASLQDLKTVVIAKTPGTGGSPQGSFADGQPAERRASNDQRPQEVPAEA    981 - 1050
LAPAPAEVPAPAPAAASASGPAKTPAPAEASTSALVPEETPVEAPAPPPAEAPAQYPSEHLIQATSEENQ   1051 - 1120
IPSHLPACPSLRHVASLRGSAIIELFHSSIAEVENEELRHLMWSSVVFYQTPGLEVTACVLLSTKAVYFV   1121 - 1190
LHDGLRRYFSEPLQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQHFRLTGSTPMQVVTCLTR   1191 - 1260
DSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTF   1261 - 1330
TVAQKMAEPEKAPALSILLYVQAFQVGMPPPGCCRGPLRPKTLLLTSSEIFLLDEDCVHYPLPEFAKEPP   1331 - 1400
QRDRYRLDDGRRVRDLDRVLMGYQTYPQALTLVFDDVQGHDLMGSVTLDHFGEVPGGPARASQGREVQWQ   1401 - 1470
VFVPSAESREKLISLLARQWEALCGRELPVELTG                                       1471 - 1504
//

Text Mined References (38)

PMID Year Title
25724667 2015 Frequent Loss of NISCH Promotes Tumor Proliferation and Invasion in Ovarian Cancer via Inhibiting the FAK Signal Pathway.
25695373 2015 Expression of integrin-binding protein Nischarin in metastatic breast cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23572524 2013 Integrin-binding protein nischarin interacts with tumor suppressor liver kinase B1 (LKB1) to regulate cell migration of breast epithelial cells.
23503203 2013 Cigarette smoke induces methylation of the tumor suppressor gene NISCH.
23386062 2013 Rac and Rab GTPases dual effector Nischarin regulates vesicle maturation to facilitate survival of intracellular bacteria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22483786 An "I" on cardiac hypertrophic remodelling: imidazoline receptors and heart disease.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
More...