Property Summary

NCBI Gene PubMed Count 31
PubMed Score 562.72
PubTator Score 227.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.400 2.9e-04
osteosarcoma -1.137 2.3e-05
atypical teratoid / rhabdoid tumor -1.200 5.3e-06
glioblastoma -1.300 2.7e-06
adult high grade glioma -1.300 1.4e-05
posterior fossa group A ependymoma -1.100 9.0e-09
subependymal giant cell astrocytoma -1.601 1.6e-02
ovarian cancer -2.200 2.3e-10
pituitary cancer -1.100 5.6e-05

Gene RIF (20)

PMID Text
25724667 Data found that NISCH was significantly downregulated in ovarian neoplasm through its promotor silencing with hypermethylation and its expression was correlated with poor prognosis.
25695373 Nischarin expression may therefore be used as a marker to predict the invasiveness and metastasis of primary breast cancer
23572524 unctional interaction between LKB1 and Nischarin to inhibit cell migration and breast tumor progression
23503203 Tobacco smoke induces methylation changes in the NISCH gene promoter before any detectable cancer.
22483786 Imidazoline receptor 1 gene plays a role in the development of cardiac hypertrophy and ventirular remodeling.
21917605 Nischarin reduces alpha5 integrin expression leading to reduction of FAK phosphorylation and Rac GTP loading, which in turn reduces tumor growth. NISCH also regulates PAK and LIMK signaling.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18561481 shows strong affinity to clonidine and regulates blood pressure.
16598778 The signaling pathway of IRAS in response to I1R agonists coupled with the activation of PC-PLC and its downstream signal transduction molecule, ERK. These findings are similar to those in the signaling pathways of native I1R.
15475348 PX domain of imidazoline receptor antisera-selected protein(IRAS) is essential for association with phosphatidylinositol 3-phosphate-enriched endosomal membranes but is insufficient without coiled-coil domain
15028623 platelets lacked the 170-kD form of IRAS, but 33-kD and 85-kD bands were detectable and seemed to be possible fragments of full-length IRAS
15028622 Results suggest that imidazoline-1 receptors (I(1)R) and alpha(2)-noradrenergic receptors (alpha(2)AR) may interact with each other.
15028621 Results describe three alternatively spliced transcripts of the human I(1)-imidazoline receptor candidate gene, IRAS.
15028619 Results suggest that IRAS may represent a previously unknown anti-apoptotic protein involved in the regulation of cell survival.
12868002 hIRAS expression in PC12 cells resulted in protection against apoptosis
12865160 I(1)-receptors can abrogate the primary signaling cascade activated by NGF, most likely by increasing levels of a specific phosphatase to return dually phosphorylated ERK to its unphosphorylated state.
12021582 The heart possesses imidazoline I1-receptors that are up-regulated in the presence of hypertension or heart failure, which suggests their involvement in cardiovascular regulation.
11912194 Insulin receptor substrate 4 associates with the protein IRAS (IRAS protein)

AA Sequence

MATARTFGPEREAEPAKEARVVGSELVDTYTVYIIQVTDGSHEWTVKHRYSDFHDLHEKLVAERKIDKNL      1 - 70
LPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQL     71 - 140
LGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLP    141 - 210
FDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVT    211 - 280
AVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL    281 - 350
HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDY    351 - 420
RTKVLAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEVKSKLSNPEKKGGEDSRLSAAPCIRPSSS    421 - 490
PPTVAPASASLPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQGCSDSLESIPAGQAASDDLRDV    491 - 560
PGAVGGASPEHAEPEVQVVPGSGQIIFLPFTCIGYTATNQDFIQRLSTLIRQAIERQLPAWIEAANQREE    561 - 630
GQGEQGEEEDEEEEEEEDVAENRYFEMGPPDVEEEEGGGQGEEEEEEEEDEEAEEERLALEWALGADEDF    631 - 700
LLEHIRILKVLWCFLIHVQGSIRQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTE    701 - 770
FGFLMPELCLVLKVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLT    771 - 840
FYKVAGGCQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEAVKSAAIPYWL    841 - 910
LLTPQHLNVIKADFNPMPNRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCTQPRGAFADGHVLELLVGYRF    911 - 980
VTAIFVLPHEKFHFLRVYNQLRASLQDLKTVVIAKTPGTGGSPQGSFADGQPAERRASNDQRPQEVPAEA    981 - 1050
LAPAPAEVPAPAPAAASASGPAKTPAPAEASTSALVPEETPVEAPAPPPAEAPAQYPSEHLIQATSEENQ   1051 - 1120
IPSHLPACPSLRHVASLRGSAIIELFHSSIAEVENEELRHLMWSSVVFYQTPGLEVTACVLLSTKAVYFV   1121 - 1190
LHDGLRRYFSEPLQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQHFRLTGSTPMQVVTCLTR   1191 - 1260
DSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTF   1261 - 1330
TVAQKMAEPEKAPALSILLYVQAFQVGMPPPGCCRGPLRPKTLLLTSSEIFLLDEDCVHYPLPEFAKEPP   1331 - 1400
QRDRYRLDDGRRVRDLDRVLMGYQTYPQALTLVFDDVQGHDLMGSVTLDHFGEVPGGPARASQGREVQWQ   1401 - 1470
VFVPSAESREKLISLLARQWEALCGRELPVELTG                                       1471 - 1504
//

Text Mined References (38)

PMID Year Title
25724667 2015 Frequent Loss of NISCH Promotes Tumor Proliferation and Invasion in Ovarian Cancer via Inhibiting the FAK Signal Pathway.
25695373 2015 Expression of integrin-binding protein Nischarin in metastatic breast cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23572524 2013 Integrin-binding protein nischarin interacts with tumor suppressor liver kinase B1 (LKB1) to regulate cell migration of breast epithelial cells.
23503203 2013 Cigarette smoke induces methylation of the tumor suppressor gene NISCH.
23386062 2013 Rac and Rab GTPases dual effector Nischarin regulates vesicle maturation to facilitate survival of intracellular bacteria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22483786 An "I" on cardiac hypertrophic remodelling: imidazoline receptors and heart disease.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21917605 2011 Molecular characterization of the tumor-suppressive function of nischarin in breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18561481 2008 [Imidazoline receptor].
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16598778 2006 Involvement of phosphatidylcholine-selective phospholipase C in activation of mitogen-activated protein kinase pathways in imidazoline receptor antisera-selected protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475348 2004 Human Nischarin/imidazoline receptor antisera-selected protein is targeted to the endosomes by a combined action of a PX domain and a coiled-coil region.
15028623 2003 Relationship between platelet imidazoline receptor-binding peptides and candidate imidazoline-1 receptor, IRAS.
15028622 2003 Intracellular effect of imidazoline receptor on alpha(2A)-noradrenergic receptor.
15028621 2003 IRAS splice variants.
15028619 2003 IRAS is an anti-apoptotic protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12868002 2003 IRAS, the human homologue of Nischarin, prolongs survival of transfected PC12 cells.
12865160 2003 The I(1)-imidazoline receptor in PC12 pheochromocytoma cells reverses NGF-induced ERK activation and induces MKP-2 phosphatase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12021582 2002 Imidazoline receptors in the heart: characterization, distribution, and regulation.
11912194 2002 Insulin receptor substrate 4 associates with the protein IRAS.
11121431 2000 Nischarin, a novel protein that interacts with the integrin alpha5 subunit and inhibits cell migration.
10882231 2000 Imidazoline receptor antisera-selected (IRAS) cDNA: cloning and characterization.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9851558 1998 Characterization of a partial cDNA clone detected by imidazoline receptor-selective antisera.