Property Summary

NCBI Gene PubMed Count 13
PubMed Score 213.35
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.101 7.0e-03
astrocytic glioma 1.200 3.4e-02
Astrocytoma, Pilocytic 1.500 3.1e-06
atypical teratoid / rhabdoid tumor 1.600 3.3e-05
ependymoma 1.300 2.9e-02
Gaucher disease type 1 -1.400 1.9e-02
glioblastoma 1.400 1.0e-02
group 4 medulloblastoma 1.400 4.4e-03
lung cancer 1.100 1.8e-02
medulloblastoma, large-cell 2.100 9.3e-07
oligodendroglioma 1.200 2.6e-02
osteosarcoma 2.371 1.8e-06
ovarian cancer -2.200 1.5e-07
tuberculosis -1.200 1.9e-06

Gene RIF (2)

AA Sequence

MAEHPPLLDTTQILSSDISLLSAPIVSADGTQQVILVQVNPGEAFTIRREDGQFQCITGPAQVPMMSPNG      1 - 70
SVPPIYVPPGYAPQVIEDNGVRRVVVVPQAPEFHPGSHTVLHRSPHPPLPGFIPVPTMMPPPPRHMYSPV     71 - 140
TGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPSSPQK    141 - 210
CPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDTEIEEKDEETKAFEALLSNIVKPVASDIQAR    211 - 280
TVVLTWSPPSSLINGETDESSVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPAMDYHAKVQAE    281 - 350
YNSIKGTPSEAEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGEFCQC    351 - 420
YMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLTKAGITWLSLQWSKP    421 - 490
SGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTC    491 - 560
PDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNP    561 - 630
GCFYRLRVYCISDGGQSAVSESLLVQTPAVPPGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVE    631 - 700
MSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAPGPPDQCKPPQVTCR    701 - 770
SATCAQVNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPF    771 - 840
SEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKV    841 - 910
TSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVAFSHQNLKLKWGEGTPKTLS    911 - 980
TDSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNESTSYKFCIQACNEAGEGPLSQEYIFTTPKSVPAAL    981 - 1050
KAPKIEKVNDHICEITWECLQPMKGDPVIYSLQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCA   1051 - 1120
IRQCQDSLGHQDLVGPYSTTVLFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAF   1121 - 1190
IIQYFVIK                                                                 1191 - 1198
//

Text Mined References (21)

PMID Year Title