Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.27
PubTator Score 2.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -2.400 3.6e-05
astrocytic glioma -1.400 1.3e-02
Astrocytoma, Pilocytic -1.800 3.6e-08
atypical teratoid / rhabdoid tumor -2.200 6.3e-04
Breast cancer -1.600 6.9e-05
chronic rhinosinusitis -1.011 1.1e-02
ductal carcinoma in situ 1.100 1.1e-02
ependymoma -1.900 7.6e-12
glioblastoma -2.400 2.1e-08
group 4 medulloblastoma -2.100 6.3e-06
interstitial cystitis -1.500 7.1e-04
intraductal papillary-mucinous adenoma (... 1.400 2.5e-05
intraductal papillary-mucinous carcinoma... 1.300 9.3e-05
intraductal papillary-mucinous neoplasm ... 1.500 5.7e-04
invasive ductal carcinoma 1.200 5.2e-04
lung carcinoma 1.700 1.7e-25
medulloblastoma, large-cell -2.800 4.3e-06
osteosarcoma -1.726 1.4e-03
ovarian cancer -2.000 7.8e-06
psoriasis -1.300 4.3e-52
spina bifida -1.570 3.7e-02
subependymal giant cell astrocytoma -2.029 2.2e-02
ulcerative colitis -1.700 1.8e-06

Synonym

Gene

PDB

2D9Y   2YRY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSNKTGGKRPATTNSDIPNHNMVSEVPPERPSVRATRTARKAVAFGKRSHSMKRNPNAPVTKAGWLFKQA      1 - 70
SSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSA     71 - 140
ESPEEQEAWIQAMGEAARVQIPPAQKSVPQAVRHSHEKPDSENVPPSKHHQQPPHNSLPKPEPEAKTRGE    141 - 210
GDGRGCEKAERRPERPEVKKEPPVKANGLPAGPEPASEPGSPYPEGPRVPGGGEQPAQPNGWQYHSPSRP    211 - 280
GSTAFPSQDGETGGHRRSFPPRTNPDKIAQRKSSMNQLQQWVNLRRGVPPPEDLRSPSRFYPVSRRVPEY    281 - 350
YGPYSSQYPDDYQYYPPGVRPESICSMPAYDRISPPWALEDKRHAFRNGGGPAYQLREWKEPASYGRQDA    351 - 420
TVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARFERLPPRSED    421 - 490
IYADPAAYVMRRSISSPKVPPYPEVFRDSLHTYKLNEQDTDKLLGKLCEQNKVVREQDRLVQQLRAEKES    491 - 560
LESALMGTHQELEMFGSQPAYPEKLRHKKDSLQNQLINIRVELSQATTALTNSTIEYEHLESEVSALHDD    561 - 630
LWEQLNLDTQNEVLNRQIQKEIWRIQDVMEGLRKNNPSRGTDTAKHRGGLGPSATYSSNSPASPLSSASL    631 - 700
TSPLSPFSLVSGSQGSPTKPGSNEPKANYEQSKKDPHQTLPLDTPRDISLVPTRQEVEAEKQAALNKVGV    701 - 770
VPPRTKSPTDDEVTPSAVVRRNASGLTNGLSSQERPKSAVFPGEGKVKMSVEEQIDRMRRHQSGSMREKR    771 - 840
RSLQLPASPAPDPSPRPAYKVVRRHRSIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHY    841 - 910
DVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQKKVERIKTLIAKSSMQNVVPIGEGDSVDVPQD    911 - 980
SESQLQEQEKRIEISCALATEASRRGRMLSVQCATPSPPTSPASPAPPANPLSSESPRGADSSYTMRV      981 - 1048
//

Text Mined References (21)

PMID Year Title