Property Summary

NCBI Gene PubMed Count 14
Grant Count 7
R01 Count 5
Funding $548,191.25
PubMed Score 5.95
PubTator Score 18.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Chronic Lymphocytic Leukemia 2.924 0.000
malignant mesothelioma 1.700 0.000
astrocytic glioma -2.500 0.004
ependymoma -3.200 0.005
oligodendroglioma -1.800 0.034
glioblastoma -2.200 0.000
sonic hedgehog group medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.500 0.001
active Crohn's disease 1.099 0.013
adult high grade glioma -2.600 0.000
pilocytic astrocytoma 1.300 0.000
aldosterone-producing adenoma -1.246 0.018
Pick disease -1.600 0.013
ovarian cancer -2.100 0.000
pituitary cancer -1.100 0.002

Gene RIF (6)

PMID Text
26430724 we identified inositol polyphosphate-5-phosphatase F (INPP5F) as a prognostic factor for progression-free survival in Chronic lymphocytic leukemia
25869669 Sac2 colocalizes with early endosomal markers and is recruited to transferrin-containing vesicles during endocytic recycling.
25476455 These findings suggest that INPP5F is a potential tumor suppressor in gliomas via inhibition of STAT3 pathway, and that deregulation of INPP5F may lead to contribution to gliomagenesis.
19875726 Inpp5f is a polyphosphoinositide phosphatase that regulates cardiac hypertrophic responsiveness.
19460752 Knockdown of inositol polyphosphate-5-phosphatase F (INPP5F) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSDLPWWLILIRQ      1 - 70
KALVGKLPGDHEVCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLKTFTHIKSN     71 - 140
VSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSLTYDLTNSVQRQSTGERDGRPLWQKVDDRFF    141 - 210
WNKYMIQDLTEIGTPDVDFWIIPMIQGFVQIEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVAL    211 - 280
ISRRSRHRAGMRYKRRGVDKNGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVGYRYNPRPRLDRS    281 - 350
EKETVAYFCAHFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKQVLLFNNSHLTYVSFDFHEHCRGMKFE    351 - 420
NVQTLTDAIYDIILDMKWCWVDEAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQLKKLGVMPPE    421 - 490
QPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSANRYYLNRFKDAYRQA    491 - 560
VIDLMQGIPVTEDLYSIFTKEKEHEALHKENQRSHQELISQLLQSYMKLLLPDDEKFHGGWALIDCDPSL    561 - 630
IDATHRDVDVLLLLSNSAYYVAYYDDEVDKVNQYQRLSLENLEKIEIGPEPTLFGKPKFSCMRLHYRYKE    631 - 700
ASGYFHTLRAVMRNPEEDGKDTLQCIAEMLQITKQAMGSDLPIIEKKLERKSSKPHEDIIGIRSQNQGSL    701 - 770
AQGKNFLMSKFSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVM    771 - 840
DKVQAESDGDMSSDNDSYHSDEFLTNSKSDEDRQLANSLESVGPIDYVLPSCGIIASAPRLGSRSQSLSS    841 - 910
TDSSVHAPSEITVAHGSGLGKGQESPLKKSPSAGDVHILTGFAKPMDIYCHRFVQDAQNKVTHLSETRSV    911 - 980
SQQASQERNQMTNQVSNETQSESTEQTPSRPSQLDVSLSATGPQFLSVEPAHSVASQKTPTSASSMLELE    981 - 1050
TGLHVTPSPSESSSSRAVSPFAKIRSSMVQVASITQAGLTHGINFAVSKVQKSPPEPEIINQVQQNELKK   1051 - 1120
MFIQCQTRIIQI                                                             1121 - 1132
//

Text Mined References (24)

PMID Year Title
26430724 2015 Gene expression of INPP5F as an independent prognostic marker in fludarabine-based therapy of chronic lymphocytic leukemia.
26203138 2015 Gene-Silencing Screen for Mammalian Axon Regeneration Identifies Inpp5f (Sac2) as an Endogenous Suppressor of Repair after Spinal Cord Injury.
25869669 2015 Spatiotemporal control of phosphatidylinositol 4-phosphate by Sac2 regulates endocytic recycling.
25869668 2015 Sac2/INPP5F is an inositol 4-phosphatase that functions in the endocytic pathway.
25476455 2014 Inositol Polyphosphate-5-Phosphatase F (INPP5F) inhibits STAT3 activity and suppresses gliomas tumorigenicity.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19875726 2009 Inpp5f is a polyphosphoinositide phosphatase that regulates cardiac hypertrophic responsiveness.
More...