Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.56
PubTator Score 18.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.099 1.3e-02
adult high grade glioma -2.600 1.1e-07
aldosterone-producing adenoma -1.246 1.8e-02
astrocytic glioma -2.500 3.6e-03
Astrocytoma, Pilocytic 1.200 2.6e-05
atypical teratoid / rhabdoid tumor -2.300 2.0e-06
Chronic Lymphocytic Leukemia 2.924 1.8e-07
ependymoma -3.200 4.8e-03
glioblastoma -1.800 7.9e-06
group 3 medulloblastoma -1.300 2.0e-03
malignant mesothelioma 1.700 2.5e-07
medulloblastoma, large-cell -3.600 1.4e-06
oligodendroglioma -1.800 3.4e-02
ovarian cancer -2.100 7.0e-08
Pick disease -1.600 1.3e-02
pituitary cancer -1.100 1.9e-03
primitive neuroectodermal tumor -1.500 7.1e-04

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSDLPWWLILIRQ      1 - 70
KALVGKLPGDHEVCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLKTFTHIKSN     71 - 140
VSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSLTYDLTNSVQRQSTGERDGRPLWQKVDDRFF    141 - 210
WNKYMIQDLTEIGTPDVDFWIIPMIQGFVQIEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVAL    211 - 280
ISRRSRHRAGMRYKRRGVDKNGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVGYRYNPRPRLDRS    281 - 350
EKETVAYFCAHFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKQVLLFNNSHLTYVSFDFHEHCRGMKFE    351 - 420
NVQTLTDAIYDIILDMKWCWVDEAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQLKKLGVMPPE    421 - 490
QPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSANRYYLNRFKDAYRQA    491 - 560
VIDLMQGIPVTEDLYSIFTKEKEHEALHKENQRSHQELISQLLQSYMKLLLPDDEKFHGGWALIDCDPSL    561 - 630
IDATHRDVDVLLLLSNSAYYVAYYDDEVDKVNQYQRLSLENLEKIEIGPEPTLFGKPKFSCMRLHYRYKE    631 - 700
ASGYFHTLRAVMRNPEEDGKDTLQCIAEMLQITKQAMGSDLPIIEKKLERKSSKPHEDIIGIRSQNQGSL    701 - 770
AQGKNFLMSKFSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVM    771 - 840
DKVQAESDGDMSSDNDSYHSDEFLTNSKSDEDRQLANSLESVGPIDYVLPSCGIIASAPRLGSRSQSLSS    841 - 910
TDSSVHAPSEITVAHGSGLGKGQESPLKKSPSAGDVHILTGFAKPMDIYCHRFVQDAQNKVTHLSETRSV    911 - 980
SQQASQERNQMTNQVSNETQSESTEQTPSRPSQLDVSLSATGPQFLSVEPAHSVASQKTPTSASSMLELE    981 - 1050
TGLHVTPSPSESSSSRAVSPFAKIRSSMVQVASITQAGLTHGINFAVSKVQKSPPEPEIINQVQQNELKK   1051 - 1120
MFIQCQTRIIQI                                                             1121 - 1132
//

Text Mined References (24)

PMID Year Title