Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.54
PubTator Score 8.31

Knowledge Summary

Patent (2,325)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.11945497544115E-10
atypical teratoid / rhabdoid tumor 4369 8.96839021391224E-8
tuberculosis and treatment for 6 months 686 5.66894005564024E-7
malignant mesothelioma 3163 5.81288133269323E-7
medulloblastoma, large-cell 6234 6.57704439499598E-7
medulloblastoma 1524 3.01741659592725E-5
hepatocellular carcinoma 550 3.96240139571093E-5
lung cancer 4473 3.3080172951415E-4
Breast cancer 3099 7.01383276620714E-4
glioblastoma 5572 7.98716278662083E-4
ovarian cancer 8492 0.00227379338439295
pediatric high grade glioma 2712 0.00304313980591701
pancreatic cancer 2300 0.00354236234727625
pancreatic carcinoma 567 0.0035423623472763
diabetes mellitus 1663 0.00616593015135146
primitive neuroectodermal tumor 3031 0.00619609660755125
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0346320733177882
astrocytic glioma 2241 0.037827127336896
Disease Target Count Z-score Confidence
Retinal Degeneration 49 3.281 1.6

Expression

Synonym

Accession Q9Y2H1 A8K4U0 B4E3J8 Q8TBX7
Symbols NDR2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Pathway (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

PMID Text
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23435566 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by triggering the switch in binding specificity of Rabin8 from PS to Sec15.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19062280 findings identify NDR1/2 as novel proapoptotic kinases and key members of the RASSF1A/MST1 signaling cascade
16488889 NDR2 is an upstream kinase of ARK5 that plays an essential role in tumor progression through ARK5
16314523 Activation of NDR2 is a multistep process involving phosphorylation of the hydrophobic motif site Thr444/2 by MST3, autophosphorylation of Ser281/2, and binding of MOB1A.
15582665 The NDR1 and NDR2 kinases were incorporated into HIV-1 particles and were cleaved by the HIV-1 protease.
15582665 Two related serine-threonine kinases, nuclear Dbf2 related 1 (NDR1) and NDR2, are incorporated into HIV-1 particles and are cleaved by the HIV-1 protease (PR), both within virions and within producer cells
15067004 NDR1 and NDR2 serine-threonine kinases are regulated by mob proteins

AA Sequence

MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH      1 - 70
ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD     71 - 140
ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI    141 - 210
HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA    211 - 280
YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI    281 - 350
SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL    351 - 420
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL                              421 - 464
//

Text Mined References (29)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23897809 2013 Cyclin D1 promotes cell cycle progression through enhancing NDR1/2 kinase activity independent of cyclin-dependent kinase 4.
23435566 2013 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by switching binding specificity from phosphatidylserine to Sec15.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21262772 2011 Human NDR kinases control G(1)/S cell cycle transition by directly regulating p21 stability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...