Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 15.46
PubTator Score 8.31

Knowledge Summary

Patent (2,325)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.100 6.8e-03
astrocytic glioma 1.100 3.8e-02
atypical teratoid / rhabdoid tumor -2.100 9.0e-08
Breast cancer 1.300 7.0e-04
diabetes mellitus -1.200 6.2e-03
ependymoma 1.100 2.3e-10
glioblastoma 1.300 7.2e-04
group 4 medulloblastoma -1.300 1.1e-03
hepatocellular carcinoma 1.200 4.0e-05
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-02
lung cancer 1.100 1.4e-03
malignant mesothelioma -2.400 5.4e-08
medulloblastoma, large-cell -2.500 6.6e-07
ovarian cancer 1.600 2.3e-03
pancreatic cancer 1.200 3.5e-03
pancreatic carcinoma 1.200 3.5e-03
primitive neuroectodermal tumor -1.300 6.2e-03
tuberculosis -2.300 1.8e-06

Gene RIF (10)

AA Sequence

MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH      1 - 70
ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD     71 - 140
ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI    141 - 210
HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA    211 - 280
YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI    281 - 350
SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL    351 - 420
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL                              421 - 464
//

Text Mined References (29)

PMID Year Title