Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.22
PubTator Score 9.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.54863218842082E-11
ovarian cancer 8492 1.3488946934149E-8
psoriasis 6685 6.46941584455664E-6
medulloblastoma, large-cell 6234 1.93182529806075E-4
atypical teratoid / rhabdoid tumor 4369 6.12485486757926E-4
adult high grade glioma 2148 0.0020077036728525
non primary Sjogren syndrome sicca 840 0.018695714134537

Expression

  Differential Expression (7)

Synonym

Accession Q9Y2H0 E1P5T5 Q5QPG4 Q5T2Y4 Q5T2Y5 Q9H137 Q9H138 Q9H1L7 DAP-4
Symbols DAP4
DLP4
DAP-4
SAPAP4
SAPAP-4

Gene

  Ortholog (12)

Gene RIF (5)

PMID Text
24986922 Significant epigenetic remodelling of the DLGAP4 locus triggered by the t(8;20)(p12;q11.23) translocation and leading to dysregulation of DLGAP4 expression in affected carriers is reported.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of discs, large (Drosophila) homolog-associated protein 4 (DLGAP4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
10521485 Shows that an homologous rat protein can interact with nArgBP2, a novel neural member of the ponsin/ArgB/vinexin family.
9115257 Includes the identification and characterization of an homologous protein in rat.

AA Sequence

MKGLGDSRPRHLSDSLDPPHEPLFAGTDRNPYLLSPTEAFAREARFPGQNTLPGDGLFPLNNQLPPPSST      1 - 70
FPRIHYNSHFEVPEESPFPSHAQATKINRLPANLLDQFEKQLPIHRDGFSTLQFPRGEAKARGESPGRIR     71 - 140
HLVHSVQRLFFTKAPSLEGTAGKVGGNGSKKGGMEDGKGRRAKSKERAKAGEPKRRSRSNISGWWSSDDN    141 - 210
LDGEAGAFRSSGPASGLMTLGRQAERSQPRYFMHAYNTISGHMLKTTKNNTTELTAPPPPPAPPATCPSL    211 - 280
GVGTDTNYVKRGSWSTLTLSHAHEVCQKTSATLDKSLLKSKSCHQGLAYHYLQVPGGGGEWSTTLLSPRE    281 - 350
TDAAAEGPIPCRRMRSGSYIKAMGDEDSDESGGSPKPSPKTAARRQSYLRATQQSLGEQSNPRRSLDRLD    351 - 420
SVDMLLPSKCPSWEEDYTPVSDSLNDSSCISQIFGQASLIPQLFGHEQQVREAELSDQYEAACESACSEA    421 - 490
ESTAAETLDLPLPSYFRSRSHSYLRAIQAGCSQEEDSVSLQSLSPPPSTGSLSNSRTLPSSSCLVAYKKT    491 - 560
PPPVPPRTTSKPFISVTVQSSTESAQDTYLDSQDHKSEVTSQSGLSNSSDSLDSSTRPPSVTRGGVAPAP    561 - 630
EAPEPPPKHAALKSEQGTLTSSESHPEAAPKRKLSSIGIQVDCIQPVPKEEPSPATKFQSIGVQVEDDWR    631 - 700
SSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDP    701 - 770
ALEASSLPPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLG    771 - 840
KVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSW    841 - 910
QLVETPEKRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRLLAAKRAASVRQNSATESADS    911 - 980
IEIYVPEAQTRL                                                              981 - 992
//

Text Mined References (22)

PMID Year Title
24986922 2014 Epigenetic remodelling and dysregulation of DLGAP4 is linked with early-onset cerebellar ataxia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22510267 2012 Sequence and expression analysis of gaps in human chromosome 20.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19041681 2009 Gene profiles of a human bronchial epithelial cell line after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...