Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 6.7e-03
medulloblastoma, large-cell -1.100 2.1e-04
oligodendroglioma -1.500 4.1e-02
osteosarcoma -1.955 1.1e-04
ovarian cancer -1.700 3.0e-08
pancreatic cancer 1.100 9.4e-04
pancreatic carcinoma 1.100 9.4e-04
psoriasis -2.300 3.5e-05

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MEVRKLSISWQFLIVLVLILQILSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKF      1 - 70
IQISKAYEILSNEEKRSNYDQYGDAGENQGYQKQQQQREYRFRHFHENFYFDESFFHFPFNSERRDSIDE     71 - 140
KYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEELGVGIGVVHAGYERRLAHHL    141 - 210
GAHSTPSILGIINGKISFFHNAVVRENLRQFVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHVLLFDQT    211 - 280
PIVPLLYKLTAFAYKDYLSFGYVYVGLRGTEEMTRRYNINIYAPTLLVFKEHINRPADVIQARGMKKQII    281 - 350
DDFITRNKYLLAARLTSQKLFHELCPVKRSHRQRKYCVVLLTAETTKLSKPFEAFLSFALANTQDTVRFV    351 - 420
HVYSNRQQEFADTLLPDSEAFQGKSAVSILERRNTAGRVVYKTLEDPWIGSESDKFILLGYLDQLRKDPA    421 - 490
LLSSEAVLPDLTDELAPVFLLRWFYSASDYISDCWDSIFHNNWREMMPLLSLIFSALFILFGTVIVQAFS    491 - 560
DSNDERESSPPEKEEAQEKTGKTEPSFTKENSSKIPKKGFVEVTELTDVTYTSNLVRLRPGHMNVVLILS    561 - 630
NSTKTSLLQKFALEVYTFTGSSCLHFSFLSLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLA    631 - 700
LNGHKKYFCLFKPQKTVEEEEAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMERLLEGSL    701 - 770
QRFYIPSWPELD                                                              771 - 782
//

Text Mined References (9)

PMID Year Title