Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.51
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.3e-07
tuberculosis 2010 3.0e-05
group 4 medulloblastoma 1855 1.1e-03
lung cancer 4740 2.3e-03
spina bifida 1074 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.100 1.1e-03
lung cancer 1.500 2.3e-03
malignant mesothelioma -4.400 3.3e-07
spina bifida -1.276 3.5e-02
tuberculosis -1.200 3.0e-05

Gene RIF (2)

AA Sequence

MARDLVMFRDVAVDFSQEEWECLNSYQRNLYRDVILENYSNLVSLAGCSISKPDVITLLEQGKEPWMVVR      1 - 70
DEKRRWTLDLESRYDTKKLFQGKDIYEMNLSQWKVMERIKSCGLEEQESPHEVCFRQVTKTTSEKMPTYR     71 - 140
KLTSLPLYQKSHNREKPYECGECGKAFRVRQQLTFHQRIHTGEKPYECKECGKAFRQCAHLSRHQRIHTS    141 - 210
DKLYECKKCGKIFTCGSDLRVHQRIHIGEKPYECKECGKAFRVRGQLNLHQRIHTGEKPYECKECGKAFR    211 - 280
QYAHLTRHQRLNIAEKCYECKECGQAFLCSTGLRLHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHTG    281 - 350
EKPYDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECQKFFRRYSELISHQGIHIGEKPYECKECGKAFR    351 - 420
LFSQLTQHQSIHFGEKPFKCKECEKTFRLLSQLTQHQSIHTGEKPYDCKECGKAFRLHSSLIQHQRIHSG    421 - 490
EKPYKCKECKKAFRQHSHLTYHQRIHNVT                                             491 - 519
//

Text Mined References (9)

PMID Year Title