Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 5
Funding $529,360.07
PubMed Score 12.86
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.200 0.027
osteosarcoma 2.352 0.000
astrocytoma 1.300 0.002
ovarian cancer 1.400 0.000

Gene RIF (3)

PMID Text
25544610 POFUT2 and B3GLCT mediate a noncanonical endoplasmic reticulum quality-control mechanism that recognizes folded thrombospondin type 1 repeats and stabilizes them by glycosylation.
22588082 Structure of human POFUT2: insights into thrombospondin type 1 repeat fold and O-fucosylation.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLL      1 - 70
KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL     71 - 140
QSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNT    141 - 210
SARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKL    211 - 280
GSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV    281 - 350
RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE    351 - 420
QPTHWKITY                                                                 421 - 429
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25544610 2015 Peters plus syndrome mutations disrupt a noncanonical ER quality-control mechanism.
22588082 2012 Structure of human POFUT2: insights into thrombospondin type 1 repeat fold and O-fucosylation.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17395589 2007 O-fucosylation is required for ADAMTS13 secretion.
17395588 2007 O-fucosylation of thrombospondin type 1 repeats in ADAMTS-like-1/punctin-1 regulates secretion: implications for the ADAMTS superfamily.
16464858 2006 Two distinct pathways for O-fucosylation of epidermal growth factor-like or thrombospondin type 1 repeats.
16464857 2006 Protein O-fucosyltransferase 2 adds O-fucose to thrombospondin type 1 repeats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...