Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.53
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.300 2.4e-03
ependymoma 1.200 2.7e-02
osteosarcoma 2.352 3.5e-10
ovarian cancer -1.200 2.7e-08

Gene RIF (4)

AA Sequence

MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLL      1 - 70
KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL     71 - 140
QSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNT    141 - 210
SARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKL    211 - 280
GSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV    281 - 350
RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE    351 - 420
QPTHWKITY                                                                 421 - 429
//

Text Mined References (18)

PMID Year Title