Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.86
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.47208438983037E-10
ovarian cancer 8492 5.69376582936113E-6
astrocytoma 1493 0.00240105407996075
ependymoma 2514 0.0272934104051293
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 3.216 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.200 0.027
osteosarcoma 2.352 0.000
astrocytoma 1.300 0.002
ovarian cancer 1.400 0.000

Synonym

Accession Q9Y2G5 Q6PJV1 Q7Z4N0 Q8WWU6 Q9BQS4 Q9BQS5 Q9UFY3
Symbols FUT13
C21orf80

Gene

PANTHER Protein Class (2)

PDB

4AP5   4AP6  

  Ortholog (15)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25544610 POFUT2 and B3GLCT mediate a noncanonical endoplasmic reticulum quality-control mechanism that recognizes folded thrombospondin type 1 repeats and stabilizes them by glycosylation.
22588082 Structure of human POFUT2: insights into thrombospondin type 1 repeat fold and O-fucosylation.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLL      1 - 70
KTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVL     71 - 140
QSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNT    141 - 210
SARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKL    211 - 280
GSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV    281 - 350
RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE    351 - 420
QPTHWKITY                                                                 421 - 429
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25544610 2015 Peters plus syndrome mutations disrupt a noncanonical ER quality-control mechanism.
22588082 2012 Structure of human POFUT2: insights into thrombospondin type 1 repeat fold and O-fucosylation.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17395589 2007 O-fucosylation is required for ADAMTS13 secretion.
17395588 2007 O-fucosylation of thrombospondin type 1 repeats in ADAMTS-like-1/punctin-1 regulates secretion: implications for the ADAMTS superfamily.
16464858 2006 Two distinct pathways for O-fucosylation of epidermal growth factor-like or thrombospondin type 1 repeats.
16464857 2006 Protein O-fucosyltransferase 2 adds O-fucose to thrombospondin type 1 repeats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...