Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.67
PubTator Score 12.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 2.900 2.5e-02
glioblastoma -1.600 2.1e-03
group 4 medulloblastoma -1.800 4.0e-03
intraductal papillary-mucinous carcinoma... -1.600 1.4e-02
malignant mesothelioma 3.500 2.1e-07
medulloblastoma, large-cell -2.700 3.2e-04
osteosarcoma -1.352 1.5e-02
ovarian cancer 2.300 2.0e-04
pituitary cancer 1.300 1.7e-04
psoriasis -1.100 1.6e-08
spina bifida -1.426 3.9e-02

Gene RIF (6)

AA Sequence

MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAGCDLDV      1 - 70
QDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGFSQSAKLLIKAGANVLAKNKA     71 - 140
GNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTA    141 - 210
LHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRER    211 - 280
LKEERRAQSVPRDEVAQSKGSVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSD    281 - 350
PTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK    351 - 420
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRLQQHSDTEKHE    421 - 490
GEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVDQLVVTAGPAAASDSSPPVVR    491 - 560
PKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAARSDQQAGPCVNRGTQTKKSGKSGPTR    561 - 630
HRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQ    631 - 700
DKATLKEHIKSLEEELAKLRTRVQKEN                                               701 - 727
//

Text Mined References (19)

PMID Year Title