Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $47,386
PubMed Score 17.67
PubTator Score 12.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 3.500 0.000
psoriasis -1.400 0.017
osteosarcoma -1.352 0.015
glioblastoma -1.600 0.002
medulloblastoma, large-cell -3.200 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.014
Breast cancer 2.900 0.025
group 4 medulloblastoma -1.900 0.004
spina bifida -1.426 0.039
ovarian cancer 2.300 0.000
pituitary cancer 1.400 0.000

Gene RIF (6)

PMID Text
25200652 missense mutations in ANKRD6 are associated with neural tube defects.
24858714 study demonstrated that diversin was overexpressed in human breast cancers. Diversin could contribute to breast cancer cell proliferation and invasion.
24833088 diversin is overexpressed in human glioma and regulates glioma cell proliferation and invasion, possibly through MMP9
22580979 ANKRD6 genetic variants were associated with the muscle size and strength response to resistance training and habitual physical activity levels.
19591803 Diversin, containing several nuclear localization signals, translocates to the nucleus, where it interacts with the transcription factor AF9.
18187620 Knockdown of ankyrin repeat domain 6 (ANKRD6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAGCDLDV      1 - 70
QDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGFSQSAKLLIKAGANVLAKNKA     71 - 140
GNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTA    141 - 210
LHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRER    211 - 280
LKEERRAQSVPRDEVAQSKGSVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSD    281 - 350
PTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK    351 - 420
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRLQQHSDTEKHE    421 - 490
GEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVDQLVVTAGPAAASDSSPPVVR    491 - 560
PKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAARSDQQAGPCVNRGTQTKKSGKSGPTR    561 - 630
HRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQ    631 - 700
DKATLKEHIKSLEEELAKLRTRVQKEN                                               701 - 727
//

Text Mined References (19)

PMID Year Title
25218921 2014 Ankrd6 is a mammalian functional homolog of Drosophila planar cell polarity gene diego and regulates coordinated cellular orientation in the mouse inner ear.
25200652 2015 Genetic studies of ANKRD6 as a molecular switch between Wnt signaling pathways in human neural tube defects.
24858714 2014 Diversin is overexpressed in breast cancer and accelerates cell proliferation and invasion.
24833088 2014 Diversin is overexpressed in human gliomas and its depletion inhibits proliferation and invasion.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22580979 2012 Variants of the ankyrin repeat domain 6 gene (ANKRD6) and muscle and physical activity phenotypes among European-derived American adults.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19591803 2009 The planar cell polarity (PCP) protein Diversin translocates to the nucleus to interact with the transcription factor AF9.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...