Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.10
PubTator Score 4.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.200 1.4e-03
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
Breast cancer -1.200 1.4e-04
glioblastoma 1.200 4.2e-04
group 4 medulloblastoma 1.200 6.8e-05
intraductal papillary-mucinous adenoma (... 1.100 1.4e-03
intraductal papillary-mucinous carcinoma... 1.200 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.9e-03
invasive ductal carcinoma 1.100 2.6e-02
medulloblastoma, large-cell 1.500 3.7e-05
Multiple myeloma 1.049 3.8e-02
non-small cell lung cancer 1.486 1.8e-15
osteosarcoma -1.386 5.4e-03
ovarian cancer 1.500 2.5e-10
psoriasis 1.200 1.4e-45
spina bifida -1.053 4.3e-02

Gene RIF (2)

AA Sequence

MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLFEQFRRVANFY      1 - 70
FLIIFLVQLMIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNI     71 - 140
RVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGETNLKTHVAVPETALLQTVANLDTLVAVIEC    141 - 210
QQPEADLYRFMGRMIITQQMEEIVRPLGPESLLLRGARLKNTKEIFGVAVYTGMETKMALNYKSKSQKRS    211 - 280
AVEKSMNTFLIIYLVILISEAVISTILKYTWQAEEKWDEPWYNQKTEHQRNSSKILRFISDFLAFLVLYN    281 - 350
FIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFR    351 - 420
ECSINGMKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFK    421 - 490
AVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYYASSPDEKALVEAAARIGIVFIGNSEETMEVKTLGK    491 - 560
LERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESSILPKCIGGEIEKTRIHVDEFALKGLRTLCI    561 - 630
AYRKFTSKEYEEIDKRIFEARTALQQREEKLAAVFQFIEKDLILLGATAVEDRLQDKVRETIEALRMAGI    631 - 700
KVWVLTGDKHETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLS    701 - 770
LALREHEKLFMEVCRNCSAVLCCRMAPLQKAKVIRLIKISPEKPITLAVGDGANDVSMIQEAHVGIGIMG    771 - 840
KEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYCLFSQQTLYDS    841 - 910
VYLTLYNICFTSLPILIYSLLEQHVDPHVLQNKPTLYRDISKNRLLSIKTFLYWTILGFSHAFIFFFGSY    911 - 980
LLIGKDTSLLGNGQMFGNWTFGTLVFTVMVITVTVKMALETHFWTWINHLVTWGSIIFYFVFSLFYGGIL    981 - 1050
WPFLGSQNMYFVFIQLLSSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSM   1051 - 1120
CCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC                1121 - 1177
//

Text Mined References (18)

PMID Year Title