| Tbio | Caspase recruitment domain-containing protein 8 |
Inhibits NF-kappa-B activation. May participate in a regulatory mechanism that coordinates cellular responses controlled by NF-kappa-B transcription factor. May be a component of the inflammasome, a protein complex which also includes PYCARD, NALP2 and CASP1 and whose function would be the activation of proinflammatory caspases.
The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]
The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| astrocytoma | 1146 | 3.8e-20 |
| non-small cell lung cancer | 2890 | 2.2e-16 |
| ependymoma | 4679 | 3.7e-08 |
| Astrocytoma, Pilocytic | 3081 | 2.1e-06 |
| glioblastoma | 5792 | 5.3e-06 |
| malignant mesothelioma | 3232 | 5.5e-06 |
| ulcerative colitis | 1819 | 3.4e-05 |
| pediatric high grade glioma | 1064 | 7.0e-05 |
| psoriasis | 6694 | 7.6e-05 |
| atypical teratoid / rhabdoid tumor | 5112 | 2.0e-04 |
| ovarian cancer | 8520 | 4.4e-04 |
| osteosarcoma | 7950 | 5.6e-04 |
| interstitial cystitis | 2312 | 2.3e-03 |
| primitive neuroectodermal tumor | 3035 | 3.8e-03 |
| adrenocortical carcinoma | 1428 | 3.9e-03 |
| sarcoidosis | 370 | 5.6e-03 |
| primary Sjogren syndrome | 735 | 1.2e-02 |
| lung cancer | 4740 | 1.7e-02 |
| subependymal giant cell astrocytoma | 2287 | 2.6e-02 |
| group 3 medulloblastoma | 4104 | 3.6e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Crohn's disease | 321 | 3.49 | 1.7 |
| Disease | log2 FC | p |
|---|---|---|
| adrenocortical carcinoma | 1.064 | 3.9e-03 |
| astrocytoma | 1.200 | 3.8e-20 |
| Astrocytoma, Pilocytic | 1.600 | 2.1e-06 |
| atypical teratoid / rhabdoid tumor | 1.200 | 2.0e-04 |
| ependymoma | 1.400 | 3.7e-08 |
| glioblastoma | 1.400 | 5.3e-06 |
| group 3 medulloblastoma | 1.200 | 3.6e-02 |
| interstitial cystitis | 1.500 | 2.3e-03 |
| lung cancer | -1.300 | 1.7e-02 |
| malignant mesothelioma | 1.700 | 5.5e-06 |
| non-small cell lung cancer | -1.395 | 2.2e-16 |
| osteosarcoma | -1.075 | 5.6e-04 |
| ovarian cancer | -1.400 | 4.4e-04 |
| pediatric high grade glioma | 1.400 | 7.0e-05 |
| primary Sjogren syndrome | 1.300 | 1.2e-02 |
| primitive neuroectodermal tumor | 1.200 | 3.8e-03 |
| psoriasis | -2.400 | 7.6e-05 |
| sarcoidosis | 1.400 | 5.6e-03 |
| subependymal giant cell astrocytoma | 1.191 | 2.6e-02 |
| ulcerative colitis | 1.400 | 3.4e-05 |
MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDK 1 - 70 STNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAV 71 - 140 AEIHLPHFISLQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIASGTRLSIPIT 141 - 210 SNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMP 211 - 280 KELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITEKRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKE 281 - 350 NHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDP 351 - 420 YLVSYLRQQNL 421 - 431 //
