Property Summary

NCBI Gene PubMed Count 65
PubMed Score 95.54
PubTator Score 66.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma 1.064 3.9e-03
astrocytoma 1.200 3.8e-20
Astrocytoma, Pilocytic 1.600 2.1e-06
atypical teratoid / rhabdoid tumor 1.200 2.0e-04
ependymoma 1.400 3.7e-08
glioblastoma 1.400 5.3e-06
group 3 medulloblastoma 1.200 3.6e-02
interstitial cystitis 1.500 2.3e-03
lung cancer -1.300 1.7e-02
malignant mesothelioma 1.700 5.5e-06
non-small cell lung cancer -1.395 2.2e-16
osteosarcoma -1.075 5.6e-04
ovarian cancer -1.400 4.4e-04
pediatric high grade glioma 1.400 7.0e-05
primary Sjogren syndrome 1.300 1.2e-02
primitive neuroectodermal tumor 1.200 3.8e-03
psoriasis -2.400 7.6e-05
sarcoidosis 1.400 5.6e-03
subependymal giant cell astrocytoma 1.191 2.6e-02
ulcerative colitis 1.400 3.4e-05

Gene RIF (63)

AA Sequence

MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDK      1 - 70
STNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAV     71 - 140
AEIHLPHFISLQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIASGTRLSIPIT    141 - 210
SNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMP    211 - 280
KELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITEKRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKE    281 - 350
NHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDP    351 - 420
YLVSYLRQQNL                                                               421 - 431
//

Text Mined References (66)

PMID Year Title