Property Summary

NCBI Gene PubMed Count 58
Grant Count 2
R01 Count 2
Funding $87,436
PubMed Score 89.33
PubTator Score 66.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -2.400 0.000
astrocytoma 1.200 0.000
glioblastoma 1.500 0.000
osteosarcoma -2.584 0.000
ependymoma 1.400 0.000
group 3 medulloblastoma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
primitive neuroectodermal tumor 1.300 0.003
adrenocortical carcinoma 1.064 0.004
non-small cell lung cancer -1.395 0.000
lung cancer -1.300 0.017
sarcoidosis 1.400 0.006
interstitial cystitis 1.500 0.002
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 1.300 0.012
subependymal giant cell astrocytoma 1.191 0.026
ulcerative colitis 1.500 0.000
ovarian cancer 1.600 0.001

Synonym

Accession Q9Y2G2 B5KVR6 B7Z496 B7Z4A2 E9PEM7 G3XAM9 Q6PGP8 Q96P82
Symbols NDPP
DACAR
DAKAR
NDPP1
TUCAN
CARDINAL

Gene

 Grant Application (2)

PDB

4IKM  

Gene RIF (58)

PMID Text
26462578 In patients with ileal, stenotic or fistulizing Crohn's disease, the mutant-type CARD8 rs2043211 polymorphism may generate a potentially protective effect. (Meta-analysis)
26462562 There is evidence for association of gout with functional variants in CARD8, IL1B and CD14.
26283210 A novel association between CARD8 and increased risk of surgical recurrence in Crohn's disease was observed and CARD8 could be a new marker for risk stratification and prevention of recurrent surgery.
26095808 Data indicate 3 variants in 3 novel genes myc target 1 protein (MYCT1), caspase recruitment domain family member 8 (CARD8) and zinc finger protein 543 (ZNF543), associated with familial IgA nephropathy (IgAN).
25921775 CARD8 might not play a role in the pathogenesis of Tourette syndrome in Chinese Han population
25895569 The polymorphism of rs2043211 in CARD8 may be a relevant host susceptibility factor for the development of preeclampsia in the Chinese Han population.
25790751 Patients carrying genotype TT of CARD8 rs2043211 polymorphism had higher triglycerides levels compared to those carrying the AA genotype.
25564880 genetic polymorphism is associated with susceptibility to Crohn's disease under the dominant model and homozygote contrast in the European population; meta-analysis
24517500 we show that CARD8 plays a role as a negative regulator of NLRP3 inflammasome through its binding with NLRP3
24385277 ANRIL may increase the risk of ischemic stroke through regulation of the CARD8 pathway
More...

AA Sequence

MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDK      1 - 70
STNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAV     71 - 140
AEIHLPHFISLQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIASGTRLSIPIT    141 - 210
SNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMP    211 - 280
KELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITEKRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKE    281 - 350
NHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDP    351 - 420
YLVSYLRQQNL                                                               421 - 431
//

Text Mined References (59)

PMID Year Title
26462578 2015 Is the CARD8 rs2043211 polymorphism associated with susceptibility to Crohn's disease? A meta-analysis.
26462562 2015 Multiplicative interaction of functional inflammasome genetic variants in determining the risk of gout.
26283210 2015 CARD8 gene variant is a risk factor for recurrent surgery in patients with Crohn's disease.
26095808 2015 Novel genes and variants associated with IgA nephropathy by co-segregating with the disease phenotypes in 10 IgAN families.
25921775 2015 rs2043211 polymorphism in CARD8 is not associated with Tourette syndrome in a family-based association study in the Chinese Han population.
25895569 2015 The Association of CARD8 rs2043211 Polymorphism with Preeclampsia in the Chinese Han Population.
25790751 2015 CARD8 rs2043211 polymorphism is associated with gout in a Chinese male population.
25564880 2015 Association between CARD8 rs2043211 polymorphism and inflammatory bowel disease: a meta-analysis.
24517500 2014 CARD8 is a negative regulator for NLRP3 inflammasome, but mutant NLRP3 in cryopyrin-associated periodic syndromes escapes the restriction.
24385277 2014 Regulation of CARD8 expression by ANRIL and association of CARD8 single nucleotide polymorphism rs2043211 (p.C10X) with ischemic stroke.
More...