Property Summary

NCBI Gene PubMed Count 15
PubMed Score 462.01
PubTator Score 151.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis 1.439 2.6e-02
astrocytoma -1.300 1.2e-06
atypical teratoid / rhabdoid tumor -1.300 1.4e-03
cystic fibrosis -1.093 3.4e-04
Down syndrome 1.200 7.7e-03
ependymoma -2.300 2.7e-02
esophageal adenocarcinoma 1.700 1.8e-02
glioblastoma multiforme -1.300 2.6e-05
group 3 medulloblastoma -2.700 5.0e-03
intraductal papillary-mucinous adenoma (... 2.100 1.2e-05
intraductal papillary-mucinous neoplasm ... 1.400 2.8e-03
lung adenocarcinoma -1.200 4.4e-07
lung cancer -2.100 1.6e-04
medulloblastoma, large-cell -1.400 1.6e-02
non-small cell lung cancer -2.350 6.9e-21
oligodendroglioma -1.400 4.9e-06
osteosarcoma 1.535 5.0e-04
ovarian cancer -3.200 7.3e-11
pancreatic cancer 1.300 6.4e-06
pancreatic ductal adenocarcinoma liver m... 1.994 3.2e-02
pediatric high grade glioma -1.400 6.4e-03
Pick disease -1.600 1.7e-02
primitive neuroectodermal tumor -1.200 3.8e-02
progressive supranuclear palsy -1.600 1.5e-02
subependymal giant cell astrocytoma -4.043 9.1e-03

Gene RIF (5)

AA Sequence

MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSS      1 - 70
GVHHLSPPGGGPSPGRHGPLPPPGYGTPLNCNNNNGMGAAPKPFPGGTGPPIKAEPKAPYAPGTLPDSPP     71 - 140
DSGSEAYSPQQVNEPHLLRTITPETLCHVGVPSRLEHPPPPPAHLPGPPPPPPPPPHYPVLQRDLYMKAE    141 - 210
PPIPHYAAMGQGLVPTDLHHTQQSQMLHQLLQQHGAELPTHPSKKRKHSESPPSTLNAQMLNGMIKQEPG    211 - 280
TVTALPLHPTRAPSPPWPPQGPLSPGPGSLPLSIARVQTPPWHPPGAPSPGLLQDSDSLSGSYLDPNYQS    281 - 350
IKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTP    351 - 420
EGLKPLDCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMR    421 - 490
KKGKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQVPDTVFHHGRV    491 - 560
GINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEAT    561 - 630
APETGVIAQEVKEILPEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKELCKLTDNLETRIDELE    631 - 700
RWSHKLAKLRRLDSLKSTGSSGAFSHAGSQFSRAGSVPHKKRPPKVASKSSSVVPDQACISQRFLQGTII    701 - 770
ALVVVMAFSVVSMSTLYVLSLRTEEDLVDTDGSFAVSTSCLLALLRPQPPGGSEALCPWSSQSFGTTQLR    771 - 840
QSPLTTGLPGIQPSLLLVTTSLTSSAPGSAVRTLDMCSSHPCPVICCSSPTTNPTTGPSLGPSFNPGHVL    841 - 910
SPSPSPSTNRSGPSQMALLPVTNIRAKSWGLSVNGIGHSKHHKSLEPLASPAVPFPGGQGKAKNSPSLGF    911 - 980
HGRARRGALQSSVGPAEPTWAQGQSASLLAEPVPSLTSIQVLENSMSITSQYCAPGDACRPGNFTYHIPV    981 - 1050
SSGTPLHLSLTLQMNSSSPVSVVLCSLRSKEEPCEEGSLPQSLHTHQDTQGTSHRWPITILSFREFTYHF   1051 - 1120
RVALLGQANCSSEALAQPATDYHFHFYRLCD                                          1121 - 1151
//

Text Mined References (17)

PMID Year Title