Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.47
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 2.7e-06
Astrocytoma, Pilocytic -1.300 2.9e-07
atypical teratoid / rhabdoid tumor -1.600 5.8e-07
Breast cancer 1.600 2.7e-02
ependymoma -1.100 8.7e-08
glioblastoma -1.100 2.9e-07
lung adenocarcinoma -1.900 5.2e-10
medulloblastoma -1.300 1.3e-04
medulloblastoma, large-cell -1.700 3.2e-04
non-small cell lung cancer -1.060 4.8e-16
osteosarcoma 1.033 2.1e-04
ovarian cancer 1.100 9.6e-11

Gene RIF (3)

AA Sequence

MYGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRY      1 - 70
GYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYD     71 - 140
FFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEA    141 - 210
ESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMY    211 - 280
SIQPQHSHLVIQQLLGHLDANSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYA    281 - 350
LTGSYDGAVSLGTKIIKEHEERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGRTG    351 - 420
ENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLSTALMEDAEIRLFVLEILISFIDRHGNRHK    421 - 490
FSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANE    491 - 560
EVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYM    561 - 630
LPEDVFVERPRLSQNLDGVVIELLFRQSKISEVLGGSGYNSDRLCLPYIPQLTDEDRLSKRRSIGETISL    631 - 700
QVEVESRNSPEKEERVPAEEITYETLKKAIVDSVAVEEQERERRRQVVEKFQKAPFEEIAAHCGARASLL    701 - 770
QSKLNQIFEITIRPPPSPSGTITAAYGQPQNHSIPVYEMKFPDLCVY                           771 - 817
//

Text Mined References (21)

PMID Year Title