Property Summary

NCBI Gene PubMed Count 18
Grant Count 15
R01 Count 15
Funding $1,354,814.09
PubMed Score 23.42
PubTator Score 13.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.299 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.000

Gene RIF (9)

PMID Text
26564720 NHE8 is expressed in goblet cells, and the inflammatory cytokine TNF-alpha downregulates NHE8 expression by a transcriptional mechanism.
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
21666503 Exonic mutations in NHE8 cannot account for congenital sodium diarrhea.
21171650 This review defines NHE6-9 as organellar NHEs that are fairly dynamic, implying that they are subjected to intracellular trafficking and thus they continuously shuttle between organelles and the plasma membrane.
20719963 These data point to a role for the ion exchange activity of NHE8 being required to maintain endosome morphology.
20375273 EGF inhibits intestinal NHE8 gene expression by reducing its basal transcription.
19109523 Tumor necrosis factor-alpha downregulates intestinal NHE8 expression by reducing basal promoter activity.
18209477 NHE8 is expressed along the gastrointestinal tract and NHE8 is a functional Na(+)/H(+) exchanger with kinetic characteristics that differ from other apically expressed NHE isoforms.
17881426 No mutation was found in the coding regions and intron-exon boundaries of the genes for CA II, CA IV, CA XIV, kNCB1, NHE3, NHE8, NHRF1, NHRF2 and SLC26A6 amplified from genomic DNA of family members with pRTA.

AA Sequence

MGEKMAEEERFPNTTHEGFNVTLHTTLVVTTKLVLPTPGKPILPVQTGEQAQQEEQSSGMTIFFSLLVLA      1 - 70
ICIILVHLLIRYRLHFLPESVAVVSLGILMGAVIKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGY     71 - 140
SLHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFN    141 - 210
ALHVDPVLNMLVFGESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGL    211 - 280
ISALVLKHIDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPVTQILMQQT    281 - 350
LRTVAFLCETCVFAFLGLSIFSFPHKFEISFVIWCIVLVLFGRAVNIFPLSYLLNFFRDHKITPKMMFIM    351 - 420
WFSGLRGAIPYALSLHLDLEPMEKRQLIGTTTIVIVLFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVN    421 - 490
LSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTN    491 - 560
KWYEEVRQGPSGSEDDEQELL                                                     561 - 581
//

Text Mined References (21)

PMID Year Title
26564720 2016 Intestinal NHE8 is highly expressed in goblet cells and its expression is subject to TNF-? regulation.
21666503 2011 Nucleotide sequence of the Na+/H+ exchanger-8 in patients with congenital sodium diarrhea.
21171650 2011 Organellar Na+/H+ exchangers: novel players in organelle pH regulation and their emerging functions.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
20719963 2010 The sodium/proton exchanger NHE8 regulates late endosomal morphology and function.
20375273 2010 Epidermal growth factor inhibits intestinal NHE8 expression via reducing its basal transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19109523 2009 Tumor necrosis factor-{alpha} downregulates intestinal NHE8 expression by reducing basal promoter activity.
18209477 2008 Gastrointestinal distribution and kinetic characterization of the sodium-hydrogen exchanger isoform 8 (NHE8).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...