Property Summary

NCBI Gene PubMed Count 19
PubMed Score 29.29
PubTator Score 13.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Dementia 175 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.1e-06
intraductal papillary-mucinous carcinoma (IPMC) 2989 5.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Metabolic acidosis 90 3.888 1.9
Diarrhea 253 3.038 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 5.4e-05
osteosarcoma -2.299 1.1e-06

Gene RIF (10)

AA Sequence

MGEKMAEEERFPNTTHEGFNVTLHTTLVVTTKLVLPTPGKPILPVQTGEQAQQEEQSSGMTIFFSLLVLA      1 - 70
ICIILVHLLIRYRLHFLPESVAVVSLGILMGAVIKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGY     71 - 140
SLHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFN    141 - 210
ALHVDPVLNMLVFGESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGL    211 - 280
ISALVLKHIDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPVTQILMQQT    281 - 350
LRTVAFLCETCVFAFLGLSIFSFPHKFEISFVIWCIVLVLFGRAVNIFPLSYLLNFFRDHKITPKMMFIM    351 - 420
WFSGLRGAIPYALSLHLDLEPMEKRQLIGTTTIVIVLFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVN    421 - 490
LSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTN    491 - 560
KWYEEVRQGPSGSEDDEQELL                                                     561 - 581
//

Text Mined References (22)

PMID Year Title