Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.61
PubTator Score 5.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y2E6 Q0VF38
Symbols RNF155

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22388039 Our results provide molecular insight into the mechanisms by which NLRP4-DTX4 targets TBK1 for degradation.
18976975 Knockdown of deltex homolog 4 (DTX4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDT      1 - 70
GTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTM     71 - 140
GQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTG    141 - 210
PLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGP    211 - 280
NSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTR    281 - 350
PPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS    351 - 420
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPH    421 - 490
SLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIG    491 - 560
TSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD               561 - 619
//

Text Mined References (5)

PMID Year Title
22388039 2012 NLRP4 negatively regulates type I interferon signaling by targeting the kinase TBK1 for degradation via the ubiquitin ligase DTX4.
15684394 2005 Normal immune system development in mice lacking the Deltex-1 RING finger domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.