Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.82
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-05
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
colon cancer -1.500 3.0e-02
glioblastoma -1.100 3.9e-02
invasive ductal carcinoma -1.100 2.3e-02
lung cancer -1.800 2.2e-02
medulloblastoma, large-cell -1.400 1.1e-05
osteosarcoma 1.943 4.1e-03
ovarian cancer -1.700 2.5e-06
psoriasis -1.500 5.8e-08
subependymal giant cell astrocytoma -1.497 1.9e-02

Synonym

Accession Q9Y2E4 B4DPI5 Q5SS78 DIP2 homolog C
Symbols KIAA0934

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (7)

AA Sequence

MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSS      1 - 70
ASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDE     71 - 140
GSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDV    141 - 210
TTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDD    211 - 280
FEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYIL    281 - 350
TYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRK    351 - 420
DAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDA    421 - 490
NNDTAYIEYKTCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMM    491 - 560
HVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISS    561 - 630
CDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPTDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLSVLT    631 - 700
VQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEY    701 - 770
PFIRTGLLGFVGPGGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERI    771 - 840
VIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPC    841 - 910
NVLMCPHTCVTNLPKPRQKQPEIGPASVMVGNLVSGKRIAQASGRDLGQIEDNDQARKFLFLSEVLQWRA    911 - 980
QTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYA    981 - 1050
GCVPITVRPPHPQNIATTLPTVKMIVEVSRSACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKK   1051 - 1120
RPAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVL   1121 - 1190
WCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRV   1191 - 1260
RTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRV   1261 - 1330
RLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFN   1331 - 1400
SRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKSV   1401 - 1470
TECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRD   1471 - 1540
GFLADQLDPIYVAYNM                                                         1541 - 1556
//

Text Mined References (19)

PMID Year Title