Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.21
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.700 1.1e-02
atypical teratoid / rhabdoid tumor 1.800 4.8e-05
cystic fibrosis and chronic rhinosinusit... 1.057 6.2e-04
glioblastoma 1.700 1.4e-04
group 4 medulloblastoma 1.200 1.7e-03
malignant mesothelioma 2.400 9.3e-07
medulloblastoma, large-cell 1.100 1.0e-03
osteosarcoma 2.971 8.1e-07
Pick disease 2.400 5.7e-06
Pilocytic astrocytoma 1.100 4.9e-02
primitive neuroectodermal tumor 1.200 7.0e-04
psoriasis -1.100 1.3e-16

Gene RIF (10)

AA Sequence

MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYSVLVDTKMSKP      1 - 70
HLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQ     71 - 140
SKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEKIVEKVSVTQRRTRRAASVAAATTSPTPRTT    141 - 210
RGRRKSVEPPKRKKRATKEPKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKK    211 - 280
FVLESELSLHQQTDCEKNIQCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVA    281 - 350
HTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGK    351 - 420
DFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEK    421 - 490
CFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPINMNPVSTLPPRPIPHPFSHLHIHPHPHHPH    491 - 560
HLPIPPVPHLPPPPALFKSEPLNHRGQSEDNFLRHLAEKNSSAQHH                            561 - 606
//

Text Mined References (28)

PMID Year Title