Property Summary

NCBI Gene PubMed Count 35
PubMed Score 37.65
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.900 6.1e-04
astrocytic glioma -2.000 2.5e-03
Astrocytoma, Pilocytic -1.800 6.5e-06
atypical teratoid / rhabdoid tumor -1.700 2.3e-04
Breast cancer 3.800 2.2e-02
cutaneous lupus erythematosus -1.400 2.4e-03
cystic fibrosis 1.135 2.1e-05
diabetes mellitus -1.300 4.0e-02
ductal carcinoma in situ 1.900 1.9e-05
ependymoma -1.600 2.9e-02
glioblastoma -1.500 2.5e-05
group 4 medulloblastoma -1.200 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-02
invasive ductal carcinoma 1.100 3.6e-03
lung cancer 2.100 1.9e-03
lung carcinoma 1.500 1.0e-28
malignant mesothelioma -1.500 1.0e-06
medulloblastoma, large-cell -1.200 2.9e-03
nasopharyngeal carcinoma 1.300 9.7e-05
non-small cell lung cancer 1.300 1.0e-15
oligodendroglioma -2.100 1.6e-02
osteosarcoma -1.888 6.1e-03
Pick disease -1.300 2.9e-02
pituitary cancer 1.100 5.2e-03
primitive neuroectodermal tumor -1.800 7.5e-05
psoriasis -1.100 6.3e-04

Gene RIF (9)

AA Sequence

MGDWMTVTDPGLSSESKTISQYTSETKMSPSSLYSQQVLCSSIPLSKNVHSFFSAFCTEDNIEQSISYLD      1 - 70
QELTTFGFPSLYEESKGKETKRELNIVAVLNCMNELLVLQRKNLLAQENVETQNLKLGSDMDHLQSCYSK     71 - 140
LKEQLETSRREMIGLQERDRQLQCKNRNLHQLLKNEKDEVQKLQNIIASRATQYNHDMKRKEREYNKLKE    141 - 210
RLHQLVMNKKDKKIAMDILNYVGRADGKRGSWRTGKTEARNEDEMYKILLNDYEYRQKQILMENAELKKV    211 - 280
LQQMKKEMISLLSPQKKKPRERVDDSTGTVISDVEEDAGELSRESMWDLSCETVREQLTNSIRKQWRILK    281 - 350
SHVEKLDNQVSKVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATAYDDDTTSLL    351 - 420
RDCYLLEEKERLKEEWSLFKEQKKNFERERRSFTEAAIRLGLERKAFEEERASWLKQQFLNMTTFDHQNS    421 - 490
ENVKLFSAFSGSSDWDNLIVHSRQPQKKPHSVSNGSPVCMSKLTKSLPASPSTSDFCQTRSCISEHSSIN    491 - 560
VLNITAEEIKPNQVGGECTNQKWSVASRPGSQEGCYSGCSLSYTNSHVEKDDLP                    561 - 614
//

Text Mined References (42)

PMID Year Title