Property Summary

NCBI Gene PubMed Count 32
PubMed Score 36.73
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytoma -3.200 0.002
ependymoma -2.700 0.005
oligodendroglioma -2.900 0.008
cutaneous lupus erythematosus -1.400 0.002
psoriasis -1.100 0.001
glioblastoma -3.500 0.000
osteosarcoma -1.888 0.006
medulloblastoma -2.600 0.000
cystic fibrosis 1.135 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -2.900 0.000
non-small cell lung cancer 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.031
lung cancer 2.100 0.002
diabetes mellitus -1.300 0.040
Breast cancer 3.800 0.022
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.600 0.000
nasopharyngeal carcinoma 1.300 0.000
lung carcinoma 1.500 0.000
Pick disease -1.300 0.029
ductal carcinoma in situ 1.900 0.000
invasive ductal carcinoma 1.900 0.001
pituitary cancer 1.500 0.000

Synonym

Accession Q9Y2D8 A8K8W0 B4DFE3 D3DT13 J3KR02 Q6P2P8 Q6ULS1 Q7L168 Q9UIX0 ADIP
Symbols ADIP
hMsd1

Gene

PANTHER Protein Class (1)

Gene RIF (9)

PMID Text
26751642 This study determined the crystallographic structure of human Afadin in complex with LGN.
26568295 Studied afadin in complex with beta-catenin in glomeruli and in cultured mesangial cells. Found expression of afadin at mesangial intercellular junctions was greatly decreased in mesangial proliferative nephritis in rats & patients w/glomerulonephritis.
26545777 Knockdown of Wdr8 or hMsd1/SSX2IP displayed very similar mitotic defects, in which spindle microtubules became shortened and misoriented.
25926640 In airway epithelial cells, measles virus spread requires the nectin-4/afadin complex and is based on cytoplasm transfer between columnar cells.
25833712 SSX2IP-mediated microtubule anchoring is essential for proper centriole assembly and duplication. On SSX2IP knockdown, the centriolar satellites become stuck at the microtubule minus end near the centrosome.
24356449 The novel centriolar satellite protein SSX2IP targets Cep290 to the ciliary transition zone.
23452395 results showed that SSX2IP promotes the development and metastasis of hepatocellular carcinoma and contributes to the drug resistance of hepatoma cells
18028484 data shows that SSX2IP is affected in two ways that relate to the cell cycling of acute myeloid leukaemia cells
12007189 Nuclear protein SS2IP interacts with cancer-related protein SSX2 and the human homologue of a Ras-like GTPase interactor, RABIN3.

AA Sequence

MGDWMTVTDPGLSSESKTISQYTSETKMSPSSLYSQQVLCSSIPLSKNVHSFFSAFCTEDNIEQSISYLD      1 - 70
QELTTFGFPSLYEESKGKETKRELNIVAVLNCMNELLVLQRKNLLAQENVETQNLKLGSDMDHLQSCYSK     71 - 140
LKEQLETSRREMIGLQERDRQLQCKNRNLHQLLKNEKDEVQKLQNIIASRATQYNHDMKRKEREYNKLKE    141 - 210
RLHQLVMNKKDKKIAMDILNYVGRADGKRGSWRTGKTEARNEDEMYKILLNDYEYRQKQILMENAELKKV    211 - 280
LQQMKKEMISLLSPQKKKPRERVDDSTGTVISDVEEDAGELSRESMWDLSCETVREQLTNSIRKQWRILK    281 - 350
SHVEKLDNQVSKVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATAYDDDTTSLL    351 - 420
RDCYLLEEKERLKEEWSLFKEQKKNFERERRSFTEAAIRLGLERKAFEEERASWLKQQFLNMTTFDHQNS    421 - 490
ENVKLFSAFSGSSDWDNLIVHSRQPQKKPHSVSNGSPVCMSKLTKSLPASPSTSDFCQTRSCISEHSSIN    491 - 560
VLNITAEEIKPNQVGGECTNQKWSVASRPGSQEGCYSGCSLSYTNSHVEKDDLP                    561 - 614
//

Text Mined References (39)

PMID Year Title
26751642 2016 Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation.
26675238 2016 WDR8 is a centriolar satellite and centriole-associated protein that promotes ciliary vesicle docking during ciliogenesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26568295 2016 Afadin is localized at cell-cell contact sites in mesangial cells and regulates migratory polarity.
26545777 2015 The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
25926640 2015 The Nectin-4/Afadin Protein Complex and Intercellular Membrane Pores Contribute to Rapid Spread of Measles Virus in Primary Human Airway Epithelia.
25833712 2015 Centriolar satellite- and hMsd1/SSX2IP-dependent microtubule anchoring is critical for centriole assembly.
25416956 2014 A proteome-scale map of the human interactome network.
24397932 2014 Msd1/SSX2IP-dependent microtubule anchorage ensures spindle orientation and primary cilia formation.
24356449 2014 The novel centriolar satellite protein SSX2IP targets Cep290 to the ciliary transition zone.
More...