Property Summary

NCBI Gene PubMed Count 52
Grant Count 22
R01 Count 12
Funding $1,723,401.5
PubMed Score 69.63
PubTator Score 54.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 0.000

Gene RIF (35)

PMID Text
26679606 These results suggest that the hepatic functions of the human iPS-HLCs could be enhanced by ATF5, c/EBPalpha, and PROX1 transduction.
26365117 This study provides the first evidence that the methylation level of ATF5 decreased, and its mRNA expression was evidently up-regulated in glioma.
26213385 Data show that ATF5 is an essential structural protein that is required for the interaction between the mother centriole and the pericentriolar material.
25682872 Activating transcription factor 5 enhances radioresistance and malignancy in cancer.
25517360 Report a global loss of 5hmC identified three new genes (ECM1, ATF5, and EOMES) with potential anti-cancer functions that may promote the understanding of the molecular mechanisms of hepatocellular carcinoma development and progression.
25512613 the TAK1-NLK pathway is a novel regulator of basal or IL-1beta-triggered C/EBP activation though stabilization of ATF5
25294425 Low expression level of ATF5 in hepatocellular carcinoma indicated aggressive tumor behavior and predicted a worse clinical outcome.
24379400 N-terminal hydrophobic amino acids play an important role in the regulation of ATF5 protein expression in IL-1beta-mediated immune response and that ATF5 is a negative regulator for IL-1beta-induced expression of SAA1 and SAA2 in HepG2 cells.
24302293 ATF5 promotes the proliferation of HSV-1 via a potential mechanism by which ATF5 enhances the transcription of viral genes during the course of an HSV-1 infection
23876217 The 5'-untranslated region regulates ATF5 mRNA stability via nonsense-mediated mRNA decay in response to environmental stress.
More...

AA Sequence

MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTER      1 - 70
VDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPS     71 - 140
LPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDR    141 - 210
KQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTR    211 - 280
SC                                                                        281 - 282
//

Text Mined References (54)

PMID Year Title
26679606 2016 Hepatic maturation of human iPS cell-derived hepatocyte-like cells by ATF5, c/EBP?, and PROX1 transduction.
26365117 2015 DNA methylation level of promoter region of activating transcription factor 5 in glioma.
26213385 2015 ATF5 Connects the Pericentriolar Materials to the Proximal End of the Mother Centriole.
25682872 2015 Activating transcription factor 5 enhances radioresistance and malignancy in cancer cells.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25517360 2014 Integrated analyses of DNA methylation and hydroxymethylation reveal tumor suppressive roles of ECM1, ATF5, and EOMES in human hepatocellular carcinoma.
25512613 2015 Stabilization of ATF5 by TAK1-Nemo-like kinase critically regulates the interleukin-1?-stimulated C/EBP signaling pathway.
25294425 2014 High ATF5 expression is a favorable prognostic indicator in patients with hepatocellular carcinoma after hepatectomy.
24379400 2014 N-terminal hydrophobic amino acids of activating transcription factor 5 (ATF5) protein confer interleukin 1? (IL-1?)-induced stabilization.
24302293 2013 A cellular response protein induced during HSV-1 infection inhibits viral replication by interacting with ATF5.
More...