Property Summary

NCBI Gene PubMed Count 10
Grant Count 21
R01 Count 17
Funding $1,927,367.46
PubMed Score 142.02
PubTator Score 32.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma 2.704 0.000
lung cancer -1.400 0.012

Gene RIF (1)

PMID Text
17174092 activators enhanced kcat, with no effect on KM, favoring the RDS in the catalytic cycle; the activation pattern of the two mitochondrial isoforms is very different from each other and as compared to those of the cytosolic isoforms hCA I and II.

AA Sequence

MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR      1 - 70
WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG     71 - 140
SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV    141 - 210
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN    211 - 280
FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP                                     281 - 317
//

Text Mined References (14)

PMID Year Title
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
17705204 2007 Saccharin inhibits carbonic anhydrases: possible explanation for its unpleasant metallic aftertaste.
17314045 2007 Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17174092 2007 Carbonic anhydrase activators: an activation study of the human mitochondrial isoforms VA and VB with amino acids and amines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...