Property Summary

NCBI Gene PubMed Count 140
Grant Count 105
R01 Count 67
Funding $8,199,652.75
PubMed Score 120.50
PubTator Score 103.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.700 0.000

Synonym

Accession Q9Y2C9 B3Y640 B6CH35 B6RFS4 B6RFS5 Q2NKL3
Symbols CD286

Gene

PANTHER Protein Class (1)

PDB

4OM7  

Gene RIF (131)

PMID Text
26741133 TLR7 rs179008 showed some associations with post-bronchiolitis lung function deficiency, and polymorphisms of TLR4 rs4986790, and TLR6 rs5743810 in particular, with airway reactivity.
26621243 genetic polymorphism is associated with malaria disease progression in Indian patients
26548862 Study showed that MyD88 Toll/interleukin-1 receptor (TIR) domain interacted with TLR5TIR but not with TLR6TIR. The solubility of both TLR5TIR and TLR6TIR were influenced by its binding partner MyD88TIR.
26470427 Frequencies of TLR1-TLR6 two-locus haplotypes in major populations of South Urals were determined for the first time
26347747 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
26347747 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
26347747 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
26312625 Study annotated variants at 4p14 as expression quantitative trait loci (eQTL) associated with TLR6/10 and FAM114A1; findings suggest that 4p14 polymorphisms are linked to host immune response to H. pylori infection but not to its acquisition.
26226614 Dengue virus NS1 protein is the viral protein responsible for the activation of TLR2 and TLR6 during Dengue virus infection
25850295 The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found.
More...

AA Sequence

MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVS      1 - 70
DMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICK     71 - 140
EFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFA    141 - 210
IQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEY    211 - 280
LNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPH    281 - 350
APSTFKFLNFTQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH    351 - 420
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPG    421 - 490
CGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNIDQVSSEVLEGWPDSYK    491 - 560
CDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAVTVTSLCIYLDLPWYLRMVCQWTQTRRRARN    561 - 630
IPLEELQRNLQFHAFISYSEHDSAWVKSELVPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIF    631 - 700
VLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKR    701 - 770
GLFWANIRAAFNMKLTLVTENNDVKS                                                771 - 796
//

Text Mined References (143)

PMID Year Title
26741133 2016 Gene Polymorphism of Toll-Like Receptors and Lung Function at Five to Seven Years of Age after Infant Bronchiolitis.
26621243 2016 Genetic predisposition of variants in TLR2 and its co-receptors to severe malaria in Odisha, India.
26548862 2016 In Vitro Reconstitution of the Toll/Interleukin-1 Receptor (TIR) Domain Complex Between TLR5/6 and Myd88.
26470427 [DISTRIBUTION OF TWO-LOCUS HAPLOTYPES OF MICROBIAL COMPONENT SENSOR GENES TLR1 AND TLR6 IN MAJOR POPULATIONS OF SOUTH URALS].
26312625 2015 Association of 4p14 TLR locus with antibodies to Helicobacter pylori.
26226614 2015 Activation of TLR2 and TLR6 by Dengue NS1 Protein and Its Implications in the Immunopathogenesis of Dengue Virus Infection.
25850295 [Association of polymorphisms in toll-like receptor genes with atopic dermatitis in the Republic of Bashkortostan].
25765738 2015 TLR2/6 agonists and interferon-gamma induce human melanoma cells to produce CXCL10.
25741726 2015 Toll receptors instruct axon and dendrite targeting and participate in synaptic partner matching in a Drosophila olfactory circuit.
25605403 2015 Toll-like receptor 2 subfamily gene polymorphisms are associated with Bacillus Calmette-Guérin osteitis following newborn vaccination.
More...