Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.39
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q9Y2C5 B4DDV9 E7EPE8 E7EU17 Q32MB7 Q32MB8
Symbols KAIA2138

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22460716 SLC17A4 is an intestinal organic anion exporter that acts in delta-psi and Chloride dependent manners
19460752 Knockdown of solute carrier family 17 (sodium phosphate), member 4 (SLC17A4; KAIA2138) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MSTGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIAIPAMVNNTAP      1 - 70
PSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYV     71 - 140
VGAGLFISSFLTLFIPLAANAGVALLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSML    141 - 210
GSFIVLLAGGLLCQTIGWPYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDCSPG    211 - 280
WSLPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL    281 - 350
LADFLLSRKILRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI    351 - 420
APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIFGRADVQDWAK    421 - 490
EQTFTHL                                                                   491 - 497
//

Text Mined References (10)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
22460716 2012 A Na+-phosphate cotransporter homologue (SLC17A4 protein) is an intestinal organic anion exporter.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12672655 2003 Kinetic evidence that the Na-PO4 cotransporter is the molecular mechanism for Na/Li exchange in human red blood cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10319585 1999 Isolation and chromosomal mapping of a novel human gene showing homology to Na+/PO4 cotransporter.