Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.70
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 6.2e-03
atypical teratoid / rhabdoid tumor 1.200 8.5e-03
colon cancer -2.000 3.8e-05
intraductal papillary-mucinous adenoma (... -1.900 5.6e-04
intraductal papillary-mucinous neoplasm ... -1.900 8.6e-03
medulloblastoma, large-cell 1.900 2.8e-05
osteosarcoma 1.220 1.4e-05
ovarian cancer 1.200 9.1e-11
pancreatic cancer -1.300 2.1e-04
ulcerative colitis -2.700 6.4e-08

Gene RIF (2)

AA Sequence

MSTGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIAIPAMVNNTAP      1 - 70
PSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYV     71 - 140
VGAGLFISSFLTLFIPLAANAGVALLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSML    141 - 210
GSFIVLLAGGLLCQTIGWPYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDCSPG    211 - 280
WSLPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL    281 - 350
LADFLLSRKILRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI    351 - 420
APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIFGRADVQDWAK    421 - 490
EQTFTHL                                                                   491 - 497
//

Text Mined References (10)

PMID Year Title