Property Summary

NCBI Gene PubMed Count 13
PubMed Score 46.77
PubTator Score 15.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 5.4e-05

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 5.4e-05

Gene RIF (6)

AA Sequence

MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLT      1 - 70
GTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGH     71 - 140
MAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKK    141 - 210
IVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVF    211 - 280
FPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKK    281 - 350
LEELKAKEQSGTQIRKPS                                                        351 - 368
//

Text Mined References (15)

PMID Year Title