Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
R01 Count 2
Funding $583,984
PubMed Score 41.94
PubTator Score 15.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
malignant mesothelioma 3,162

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 0.000

Synonym

Accession Q9Y2C4 A8K242 B4DVG2 Q3SXM9 Q9Y2C8
Symbols ENGL
ENGLA
ENGLB
ENGL-a
ENGL-b
ENDOGL1
ENDOGL2

Gene

 Grant Application (2)

PDB

4A1N  

Gene RIF (6)

PMID Text
23986585 These data indicate that HSV-1 UL12.5 deploys cellular proteins, including ENDOG and EXOG, to destroy mtDNA and contribute to a growing body of literature highlighting roles for ENDOG and EXOG in mtDNA maintenance.
21768646 EXOG depletion induces persistent SSBs in the mtDNA, enhances ROS levels, and causes apoptosis in normal cells but not in mt genome-deficient rho0 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18187503 Human endonuclease G-like-1 is a dimeric mitochondrial enzyme that displays 5'-3' exonuclease activity and further differs from EndoG in substrate specificity
17415550 Observational study of gene-disease association. (HuGE Navigator)
17415550 ENDOGL1 is a candidate disease-susceptibility gene for type 2 diabetes in a Japanese population

AA Sequence

MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLT      1 - 70
GTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGH     71 - 140
MAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKK    141 - 210
IVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVF    211 - 280
FPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKK    281 - 350
LEELKAKEQSGTQIRKPS                                                        351 - 368
//

Text Mined References (15)

PMID Year Title
25378300 2014 Opposing roles of mitochondrial and nuclear PARP1 in the regulation of mitochondrial and nuclear DNA integrity: implications for the regulation of mitochondrial function.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24850809 2014 Genetic determinants of P wave duration and PR segment.
23986585 2013 Mitochondrial nucleases ENDOG and EXOG participate in mitochondrial DNA depletion initiated by herpes simplex virus 1 UL12.5.
21768646 2011 Apoptosis induced by persistent single-strand breaks in mitochondrial genome: critical role of EXOG (5'-EXO/endonuclease) in their repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18187503 2008 EXOG, a novel paralog of Endonuclease G in higher eukaryotes.
17415550 2007 Genetic association of single nucleotide polymorphisms in endonuclease G-like 1 gene with type 2 diabetes in a Japanese population.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
More...