Property Summary

NCBI Gene PubMed Count 11
PubMed Score 184.44
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -2.100 2.3e-07
astrocytic glioma 1.100 6.4e-03
Atopic dermatitis -1.200 3.2e-03
atypical teratoid / rhabdoid tumor -1.900 1.1e-03
cutaneous lupus erythematosus -1.100 7.5e-03
ductal carcinoma in situ -1.700 3.1e-03
group 3 medulloblastoma -2.200 2.2e-03
interstitial cystitis -1.100 7.8e-04
intraductal papillary-mucinous carcinoma... -1.800 8.4e-03
invasive ductal carcinoma -1.382 8.4e-03
lung adenocarcinoma -1.200 8.5e-14
lung cancer -2.300 1.7e-05
malignant mesothelioma -2.200 2.1e-07
medulloblastoma, large-cell -2.800 3.2e-04
oligodendroglioma 1.100 8.8e-03
pituitary cancer -1.100 1.8e-02
posterior fossa group A ependymoma 1.100 3.1e-05
primitive neuroectodermal tumor -1.700 2.6e-02

Gene RIF (6)

AA Sequence

MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGG      1 - 70
PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHN     71 - 140
KTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGE    141 - 210
QNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLL    211 - 280
VGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY    281 - 350
VKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR                  351 - 406
//

Text Mined References (12)

PMID Year Title