Property Summary

NCBI Gene PubMed Count 11
Grant Count 23
R01 Count 9
Funding $5,994,311.75
PubMed Score 165.47
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (6)

PMID Text
23620144 Statistical analysis showed the strongest evidence for a variant located in an intron of UST associated with job-related exhaustion.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360315 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17227754 analysis of differences and similarities various residues play in the biological roles of the HS-2OST and CS-2OST enzymes
16192264 2OST transfers sulfate preferentially to the GlcA residue located in a unique sequence, -GalNAc(4SO(4))-GlcA-GalNAc(6SO(4))-.

AA Sequence

MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGG      1 - 70
PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHN     71 - 140
KTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGE    141 - 210
QNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLL    211 - 280
VGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY    281 - 350
VKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR                  351 - 406
//

Text Mined References (12)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
23620144 2013 Genome-wide scan of job-related exhaustion with three replication studies implicate a susceptibility variant at the UST gene locus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360315 2010 Genome-wide pharmacogenetics of antidepressant response in the GENDEP project.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17227754 2007 Mutational study of heparan sulfate 2-O-sulfotransferase and chondroitin sulfate 2-O-sulfotransferase.
16192264 2005 Recognition of sulfation pattern of chondroitin sulfate by uronosyl 2-O-sulfotransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...