Property Summary

NCBI Gene PubMed Count 11
PubMed Score 165.47
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

  Differential Expression (18)

Synonym

Accession Q9Y2C2 B2RCX6
Symbols 2OST

Gene

UST

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
23620144 Statistical analysis showed the strongest evidence for a variant located in an intron of UST associated with job-related exhaustion.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360315 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17227754 analysis of differences and similarities various residues play in the biological roles of the HS-2OST and CS-2OST enzymes
16192264 2OST transfers sulfate preferentially to the GlcA residue located in a unique sequence, -GalNAc(4SO(4))-GlcA-GalNAc(6SO(4))-.

AA Sequence

MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGG      1 - 70
PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHN     71 - 140
KTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGE    141 - 210
QNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLL    211 - 280
VGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY    281 - 350
VKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR                  351 - 406
//

Text Mined References (12)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
23620144 2013 Genome-wide scan of job-related exhaustion with three replication studies implicate a susceptibility variant at the UST gene locus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360315 2010 Genome-wide pharmacogenetics of antidepressant response in the GENDEP project.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17227754 2007 Mutational study of heparan sulfate 2-O-sulfotransferase and chondroitin sulfate 2-O-sulfotransferase.
16192264 2005 Recognition of sulfation pattern of chondroitin sulfate by uronosyl 2-O-sulfotransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...