Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $120,783
PubMed Score 8.08
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23963683 Results show that endogenous levels of Pkig reciprocally regulate osteoblast and adipocyte differentiation and that this reciprocal regulation is mediated in part by LIF.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16870489 These results indicate that the downregulation of PKIgamma may be prerequisite for the PKA activation during the osteoblastic differentiation of precursor cells.
11742798 Functional studies of the mouse homolog
9218452 Functional studies of the mouse homolog

AA Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSS      1 - 70
DGTTSS                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title
23963683 2013 Protein kinase inhibitor ? reciprocally regulates osteoblast and adipocyte differentiation by downregulating leukemia inhibitory factor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16870489 2006 Downregulation of cAMP-dependent protein kinase inhibitor gamma is required for BMP-2-induced osteoblastic differentiation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11978406 2002 Protein inhibitor of neuronal nitric oxide synthase interacts with protein kinase A inhibitors.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11742798 2002 Vascular endothelial cells express isoforms of protein kinase A inhibitor.
More...