Property Summary

NCBI Gene PubMed Count 13
PubMed Score 150.53
PubTator Score 27.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Zunich neuroectodermal syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Sudden infant death syndrome 32 5.312 2.7
Coloboma 51 3.167 1.6
Disease Target Count
CHIME syndrome 1

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 3.7e-03
atypical teratoid / rhabdoid tumor 1.300 3.7e-04
Breast cancer -1.200 8.3e-09
lung cancer 1.100 1.1e-02
medulloblastoma 1.100 2.9e-03
medulloblastoma, large-cell 1.300 1.9e-04
osteosarcoma -1.709 2.5e-02
primitive neuroectodermal tumor 1.100 6.3e-04
psoriasis -1.400 1.9e-04

 MGI Phenotype (1)

Gene RIF (5)

AA Sequence

MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW      1 - 70
VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI     71 - 140
NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV    141 - 210
LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL                                211 - 252
//

Text Mined References (14)

PMID Year Title