Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.64
PubTator Score 10.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.006 1.8e-05
aldosterone-producing adenoma -1.064 4.3e-02
glioblastoma 1.200 9.9e-03
lung cancer 2.100 5.9e-03
osteosarcoma 1.131 5.4e-03
ovarian cancer -1.200 1.9e-02
psoriasis 1.200 1.2e-02

Gene RIF (4)

AA Sequence

MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE      1 - 70
GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT     71 - 140
QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW    141 - 210
INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS    211 - 280
SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI    281 - 350
PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH    351 - 420
FKTELKMKFTNILESSFLMNNKS                                                   421 - 443
//

Text Mined References (13)

PMID Year Title