Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.67
PubTator Score 9.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
lung cancer 2.000 0.002
ovarian cancer 1.200 0.000

Synonym

Accession Q9Y2B0 B2R7B9 Q9UHE9
Symbols MSAP
TMEM4
ZSIG9
HP10390

Gene

Gene RIF (5)

PMID Text
26835537 CNPY2 may play a critical role in colorectal cancer development by enhancing cell proliferation, migration, and angiogenesis and by inhibiting apoptosis through negative regulation of the p53 pathway
25589425 CNPY2 is a HIF-1alpha-regulated, secreted angiogenic growth factor that promotes smooth muscle cell migration, proliferation, and tissue revascularization.
22378787 Our results are consistent with an important role of FGF21 and Cnpy2/Msap in the regulation of LDLRs in cultured cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
12826659 MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain in fetal and adult brain.

AA Sequence

MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP      1 - 70
YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSDISGTLKFACESI     71 - 140
VEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHDEL                                141 - 182
//

Text Mined References (15)

PMID Year Title
26835537 2016 Decreasing CNPY2 Expression Diminishes Colorectal Tumor Growth and Development through Activation of p53 Pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25589425 2015 A secreted protein (Canopy 2, CNPY2) enhances angiogenesis and promotes smooth muscle cell migration and proliferation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
22378787 2012 Fibroblast growth factor-21 (FGF21) regulates low-density lipoprotein receptor (LDLR) levels in cells via the E3-ubiquitin ligase Mylip/Idol and the Canopy2 (Cnpy2)/Mylip-interacting saposin-like protein (Msap).
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905959 2005 MSAP enhances migration of C6 glioma cells through phosphorylation of the myosin regulatory light chain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...