Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.38
PubTator Score 9.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 4.4e-06
ovarian cancer 8520 2.0e-04
lung cancer 4740 1.8e-03

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 2.000 1.8e-03
malignant mesothelioma -1.300 4.4e-06
ovarian cancer 1.200 2.0e-04

Gene RIF (6)

AA Sequence

MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP      1 - 70
YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSDISGTLKFACESI     71 - 140
VEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHDEL                                141 - 182
//

Text Mined References (16)

PMID Year Title