Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.18
PubTator Score 4.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.04897560216039E-20
lung adenocarcinoma 2714 2.81198261557055E-12
pancreatic cancer 2300 5.99847750892711E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00100159329769399
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0186722483782731
Disease Target Count Z-score Confidence
Influenza 142 3.889 1.9

Expression

  Differential Expression (5)

Synonym

Accession Q9Y2A9 B2RAS4 Q6NWU9 Q6NXU9 Q8WWR6 Q9C0J2
Symbols TMEM3
B3GN-T3
B3GNT-3
HP10328
B3GAL-T8
beta3Gn-T3

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (5)

PMID Text
26709519 This study demonstrated that elevated B3GNT3 expression is associated with pelvic lymph node metastasis and poor outcome in early-stage cervical cancer patients.
24118321 B3GNT3 predicts a favorable cancer behavior of neuroblastoma and suppresses malignant phenotypes by modulating mucin-type O-glycosylation and signaling in neuroblastoma cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
17827388 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAPCHANTSMVTH      1 - 70
PDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQ     71 - 140
LRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGD    141 - 210
DDVFAHTDNMVFYLQDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTA    211 - 280
AALRRAAHVLDIFPIDDVFLGMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYE    281 - 350
MLLMWDALNQPNLTCGNQTQIY                                                    351 - 372
//

Text Mined References (21)

PMID Year Title
26709519 2015 B3GNT3 Expression Is a Novel Marker Correlated with Pelvic Lymph Node Metastasis and Poor Clinical Outcome in Early-Stage Cervical Cancer.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
24118321 2013 B3GNT3 expression suppresses cell migration and invasion and predicts favorable outcomes in neuroblastoma.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...