Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.08
PubTator Score 4.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 1.0e-03
lung adenocarcinoma 1.300 5.8e-12
pancreatic cancer 1.100 6.0e-05
pancreatic ductal adenocarcinoma liver m... 1.014 1.9e-02
psoriasis 1.300 4.0e-20

Protein-protein Interaction (9)

Gene RIF (5)

AA Sequence

MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAPCHANTSMVTH      1 - 70
PDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQ     71 - 140
LRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGD    141 - 210
DDVFAHTDNMVFYLQDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTA    211 - 280
AALRRAAHVLDIFPIDDVFLGMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYE    281 - 350
MLLMWDALNQPNLTCGNQTQIY                                                    351 - 372
//

Text Mined References (21)

PMID Year Title