Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.19
PubTator Score 6.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Smallpox 19 3.212 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
lung carcinoma 1.200 3.5e-17
medulloblastoma, large-cell 1.100 3.9e-05
Multiple myeloma 1.097 3.1e-03
osteosarcoma -1.889 2.6e-07
ovarian cancer -1.100 4.8e-04
Waldenstrons macroglobulinemia 1.351 5.4e-03

Synonym

Accession Q9Y296 A8K3A5 B4DME1
Symbols SBDN
TRS23
PTD009
CGI-104
HSPC172
SYNBINDIN

Gene

PANTHER Protein Class (1)

PDB

2J3T   2JSN   2ZMV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD      1 - 70
VNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETD     71 - 140
TFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE    141 - 210
KAGTFGPGS                                                                 211 - 219
//

Text Mined References (21)

PMID Year Title