Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.07
PubTator Score 6.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.351 0.005
Multiple myeloma 1.097 0.003
osteosarcoma -2.723 0.000
medulloblastoma, large-cell 1.100 0.000
lung carcinoma 1.200 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q9Y296 A8K3A5 B4DME1
Symbols SBDN
TRS23
PTD009
CGI-104
HSPC172
SYNBINDIN

Gene

PANTHER Protein Class (1)

PDB

2J3T   2JSN   2ZMV  

Gene RIF (5)

PMID Text
24104608 Synbindin contributes to malignant phenotypes of GC by activating ERK on the Golgi, and synbindin is a potential biomarker and therapeutic target for GC.
23625650 Overexpression of TRAPPC4 increased colorectal carcinogenesis.
21826244 Data demonstrate that TRAPPC4 may regulate cell proliferation and apoptosis in CRC by interaction with ERK2 and phosphorylating ERK1/2 as well as modulating the subcellular location of pERK1/2 to activate the relevant signaling pathway.
20035503 Observational study of gene-disease association. (HuGE Navigator)
18466758 The three-dimensional structure of human synbindin, which contains a longin domain and an atypical PDZ domain is presented.

AA Sequence

MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD      1 - 70
VNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETD     71 - 140
TFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE    141 - 210
KAGTFGPGS                                                                 211 - 219
//

Text Mined References (19)

PMID Year Title
24104608 2013 Synbindin in extracellular signal-regulated protein kinase spatial regulation and gastric cancer aggressiveness.
23625650 2014 The role of ERK2 in colorectal carcinogenesis is partly regulated by TRAPPC4.
21826244 2011 TRAPPC4-ERK2 interaction activates ERK1/2, modulates its nuclear localization and regulates proliferation and apoptosis of colorectal cancer cells.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21269460 2011 Initial characterization of the human central proteome.
20035503 2009 Single-cell expression profiling of dopaminergic neurons combined with association analysis identifies pyridoxal kinase as Parkinson's disease gene.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18466758 2009 Crystal structure of human synbindin reveals two conformations of longin domain.
17110339 2006 The architecture of the multisubunit TRAPP I complex suggests a model for vesicle tethering.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...