Property Summary

NCBI Gene PubMed Count 24
PubMed Score 3.52
PubTator Score 19.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.4e-04
ovarian cancer 8520 6.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.300 6.3e-04
psoriasis 1.100 5.4e-04

Gene RIF (7)

AA Sequence

MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFV      1 - 70
GFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVAR     71 - 140
TCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILA    141 - 210
EYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD    211 - 280
LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKV    281 - 350
GKDHTLEDEDVIQIVKK                                                         351 - 367
//

Text Mined References (30)

PMID Year Title