Property Summary

NCBI Gene PubMed Count 24
Grant Count 14
R01 Count 14
Funding $3,406,090.14
PubMed Score 2.36
PubTator Score 19.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.001
ovarian cancer 1.300 0.001

Gene RIF (10)

PMID Text
25993655 DRG-1 plays an important role in melanoma cell growth and transformation, indicating that DRG1 may represent a novel target for CD4(+) T cell-mediated immunotherapy in melanoma.
23711155 Lerepo4 action leaves Drg1 affinity for nucleotides unaffected, feasibly favoring a switch I reorientation, mainly via the TGS domain.
23125841 Tandem affinity purification and mass spectrometry analysis identify developmentally regulated GTP binding protein 1 (DRG1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify developmentally regulated GTP binding protein 1 (DRG1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify developmentally regulated GTP binding protein 1 (DRG1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify developmentally regulated GTP binding protein 1 (DRG1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19058789 Observational study of gene-disease association. (HuGE Navigator)
17178897 The tumor metastasis suppressor gene Drg-1 suppresses metastasis of prostate tumor cells by inhibiting the invasive ability of the cells via down-regulation of the expression of the ATF3 gene.
15184886 our results strongly suggest functional involvement of the Drg-1 gene in suppressing the metastatic advancement of human breast cancer.
12702552 Drg-1 is a candidate metastasis suppressor gene for prostate cancer and may serve as a useful prognostic marker.

AA Sequence

MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFV      1 - 70
GFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVAR     71 - 140
TCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILA    141 - 210
EYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD    211 - 280
LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKV    281 - 350
GKDHTLEDEDVIQIVKK                                                         351 - 367
//

Text Mined References (30)

PMID Year Title
25993655 2015 Identification of DRG-1 As a Melanoma-Associated Antigen Recognized by CD4+ Th1 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944354 2015 Host interactions of Chandipura virus matrix protein.
25416956 2014 A proteome-scale map of the human interactome network.
23711155 2013 Human Drg1 is a potassium-dependent GTPase enhanced by Lerepo4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19819225 2009 Independent stabilizations of polysomal Drg1/Dfrp1 complex and non-polysomal Drg2/Dfrp2 complex in mammalian cells.
More...