Property Summary

Ligand Count 1
NCBI Gene PubMed Count 54
PubMed Score 32.44
PubTator Score 33.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.400 2.9e-02
aldosterone-producing adenoma -1.003 3.4e-02
Breast cancer 2.800 3.5e-02
Chronic Lymphocytic Leukemia 1.251 1.4e-02
group 3 medulloblastoma 1.200 4.1e-03
hepatocellular carcinoma 1.200 1.3e-04
hereditary spastic paraplegia -1.049 9.1e-03
lung cancer 1.800 1.1e-02
ovarian cancer 1.400 6.5e-03
primary Sjogren syndrome 1.100 1.1e-02
tuberculosis -1.200 9.1e-03

Gene RIF (31)

AA Sequence

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNIL     71 - 140
ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM          141 - 204
//

Text Mined References (67)

PMID Year Title