Property Summary

NCBI Gene PubMed Count 48
Grant Count 15
R01 Count 4
Funding $3,634,545.91
PubMed Score 30.50
PubTator Score 33.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
chronic lymphosyte leukemia 1.300 0.000
hereditary spastic paraplegia -1.049 0.009
tuberculosis -1.200 0.009
lung cancer 1.800 0.011
Breast cancer 2.800 0.035
group 3 medulloblastoma 1.200 0.004
primary Sjogren syndrome 1.100 0.011
aldosterone-producing adenoma -1.003 0.034
acute myeloid leukemia -1.400 0.029
ovarian cancer 1.400 0.007

Gene RIF (30)

PMID Text
26945061 These data suggest that CAF-1- and ASF1A-H3-H4-dependent deposition of the histone (H3-H4)2 tetramers is compatible with MMR and protects the discontinuous daughter strand from unnecessary degradation by MMR machinery.
26336826 Data show that the ubiquitin-conjugating enzyme E2 RAD6A/B-MDM2 ubiquitin ligase machinery regulates anti-silencing function 1A protein (ASF1A) degradation.
26186914 quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
25618846 Thermodynamic analysis of the quaternary complex together with structural modeling support that ASF1 and MCM2 could form a chaperoning module for histones H3 and H4 protecting them from promiscuous interactions.
25035411 findings show that ASF1A, a histone-remodeling chaperone specifically enriched in the metaphase II oocyte, is necessary for reprogramming of adult dermal fibroblasts into undifferentiated induced pluripotent stem cell
24700029 The ATR checkpoint pathway causes a histone chaperone normally associated with the replication fork, ASF1a, to degrade through a CRL1(betaTRCP)-dependent ubiquitination/proteasome pathway, leading to the localized dechromatinization and gene repression.
24598821 Data indicate Tousled-like kinases (TLK1) phosphorylation has an impact on cell cycle proteins Asf1a and Asf1b function.
24413054 Co-depletion of the histone chaperones ASF1a and ASF1b in human cells induces all hallmarks of alternative lengthening of telomeres in both primary and cancer cells.
22951827 Asf1a plays a role in regulating IE genes by assembling chromatin onto histone-free viral DNA by 3 h postinfection with herpes simplex virus 1
22407294 The authors propose that Codanin-1 acts as a negative regulator of Asf1 function in chromatin assembly.
More...

AA Sequence

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRH      1 - 70
MFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNIL     71 - 140
ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM          141 - 204
//

Text Mined References (61)

PMID Year Title
26945061 2016 DNA Mismatch Repair Interacts with CAF-1- and ASF1A-H3-H4-dependent Histone (H3-H4)2 Tetramer Deposition.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26336826 2015 A conserved RAD6-MDM2 ubiquitin ligase machinery targets histone chaperone ASF1A in tumorigenesis.
26186914 2015 Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2.
25618846 2015 Structural insight into how the human helicase subunit MCM2 may act as a histone chaperone together with ASF1 at the replication fork.
25416956 2014 A proteome-scale map of the human interactome network.
25035411 2014 Cell reprogramming. Histone chaperone ASF1A is required for maintenance of pluripotency and cellular reprogramming.
24700029 2014 ATR checkpoint kinase and CRL1?TRCP collaborate to degrade ASF1a and thus repress genes overlapping with clusters of stalled replication forks.
24616510 2014 Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
24598821 2014 Tousled-like kinases phosphorylate Asf1 to promote histone supply during DNA replication.
More...