Property Summary

NCBI Gene PubMed Count 32
PubMed Score 77.55
PubTator Score 61.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.0e-08
malignant mesothelioma 3232 4.7e-07
lung cancer 4740 1.1e-05
colon cancer 1478 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.500 1.0e-03
lung cancer 3.700 1.1e-05
malignant mesothelioma 1.600 4.7e-07
ovarian cancer 1.200 2.0e-08

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELLMADRKMGCLP      1 - 70
VALSLLATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKT     71 - 140
VRVCGTVTFIFQMVIYMGVVLYAPSLALNAVTGFDLWLSVLALGIVCTVYTALGGLKAVIWTDVFQTLVM    141 - 210
FLGQLAVIIVGSAKVGGLGRVWAVASQHGRISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQR    211 - 280
YLSSRTEKAAVLSCYAVFPFQQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPG    281 - 350
LPGLFIACLFSGSLSTISSAFNSLATVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQM    351 - 420
GPVLQAAISIFGMVGGPLLGLFCLGMFFPCANPPGAVVGLLAGLVMAFWIGIGSIVTSMGSSMPPSPSNG    421 - 490
SSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPA    491 - 560
TIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCIL    561 - 630
QETSL                                                                     631 - 635
//

Text Mined References (34)

PMID Year Title