Property Summary

NCBI Gene PubMed Count 31
Grant Count 24
R01 Count 24
Funding $3,987,696.41
PubMed Score 67.03
PubTator Score 61.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
lung cancer 3.700 0.000
colon cancer 1.500 0.001
ovarian cancer 1.200 0.000

 GWAS Trait (1)

Gene RIF (20)

PMID Text
25999427 S. typhimurium infection inhibits intestinal biotin uptake by SLC5A6, and that the inhibition is mediated via the action of proinflammatory cytokines.
25971966 SMVT-mediated transport is highly specific for R-(+)-alpha-lipoic acid.
25809983 SLC5A6 is responsible for the supplies of biotin and pantothenic acid into the brain across the blood brain barrier.
23142496 these studies demonstrated for the first time the functional and molecular expression of sodium dependent multivitamin transporter (SMVT) in human derived breast cancer (T47D) cells
22927035 This study shows for the first time the functional and molecular presence of SMVT in immortalized human corneal epithelial (HCEC) and retinal pigment epithelial (D407) cells
22732670 This study for the first time confirms the molecular expression of SMVT and demonstrates that SMVT, responsible for biotin uptake, is functionally active in PC-3 prostate cancer cells
22304562 PCR analysis had confirmed the existence of FR-alpha, SMVT, and B ((0, +)) in Y-79 and ARPE-19 cells.
22015582 Cys(294) is essential for the function of the human sodium-dependent multivitamin transporter.
21570947 Human SMVT protein is glycosylated, and that glycosylation is important for its function. The study also shows a role for the putative PKC-phosphorylation site Thr(286) of hSMVT in the PKC-mediated regulation of biotin uptake.
21183659 PDZD11 is an interacting partner with hSMVT in intestinal epithelial cells and that this interaction affects hSMVT function and cell biology.
More...

AA Sequence

MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELLMADRKMGCLP      1 - 70
VALSLLATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKT     71 - 140
VRVCGTVTFIFQMVIYMGVVLYAPSLALNAVTGFDLWLSVLALGIVCTVYTALGGLKAVIWTDVFQTLVM    141 - 210
FLGQLAVIIVGSAKVGGLGRVWAVASQHGRISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQR    211 - 280
YLSSRTEKAAVLSCYAVFPFQQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPG    281 - 350
LPGLFIACLFSGSLSTISSAFNSLATVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQM    351 - 420
GPVLQAAISIFGMVGGPLLGLFCLGMFFPCANPPGAVVGLLAGLVMAFWIGIGSIVTSMGSSMPPSPSNG    421 - 490
SSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPA    491 - 560
TIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCIL    561 - 630
QETSL                                                                     631 - 635
//

Text Mined References (33)

PMID Year Title
25999427 2015 Salmonella infection inhibits intestinal biotin transport: cellular and molecular mechanisms.
25971966 2015 Interaction of ?-Lipoic Acid with the Human Na+/Multivitamin Transporter (hSMVT).
25809983 2015 Major involvement of Na(+) -dependent multivitamin transporter (SLC5A6/SMVT) in uptake of biotin and pantothenic acid by human brain capillary endothelial cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23142496 2013 Biotin uptake by T47D breast cancer cells: functional and molecular evidence of sodium-dependent multivitamin transporter (SMVT).
22927035 2012 Functional and molecular aspects of biotin uptake via SMVT in human corneal epithelial (HCEC) and retinal pigment epithelial (D407) cells.
22732670 2012 Molecular expression and functional activity of sodium dependent multivitamin transporter in human prostate cancer cells.
22304562 2012 Differential expression of folate receptor-alpha, sodium-dependent multivitamin transporter, and amino acid transporter (B (0, +)) in human retinoblastoma (Y-79) and retinal pigment epithelial (ARPE-19) cell lines.
22015582 2012 Cys(294) is essential for the function of the human sodium-dependent multivitamin transporter.
21570947 2011 Role of the putative N-glycosylation and PKC-phosphorylation sites of the human sodium-dependent multivitamin transporter (hSMVT) in function and regulation.
More...