Property Summary

NCBI Gene PubMed Count 58
PubMed Score 356.50
PubTator Score 111.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung adenocarcinoma 2716 2.1e-06
ovarian cancer 8520 3.9e-06
Breast cancer 3578 1.3e-05
psoriasis 6694 1.1e-04
lung cancer 4740 5.8e-04
medulloblastoma, large-cell 6241 1.2e-03
Disease Target Count Z-score Confidence
Amyloidosis 67 3.873 1.9
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.200 1.3e-05
lung adenocarcinoma -1.200 2.1e-06
lung cancer -1.200 5.8e-04
medulloblastoma, large-cell -1.400 1.2e-03
ovarian cancer -1.400 3.9e-06
psoriasis 1.300 1.1e-04

 CSPA Cell Line (2)

Gene RIF (39)

AA Sequence

MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVIL      1 - 70
GGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS     71 - 140
DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIE    141 - 210
NIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS                  211 - 266
//

Text Mined References (61)

PMID Year Title